DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and MSB4

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_014529.1 Gene:MSB4 / 854037 SGDID:S000005472 Length:492 Species:Saccharomyces cerevisiae


Alignment Length:441 Identity:79/441 - (17%)
Similarity:141/441 - (31%) Gaps:131/441 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   744 DDNDFSDISDPGDLFDEPELGQEAEEQEQSNLEEEVFEKQEDEEDQEDHDQREMPRLSEKLVLEF 808
            ||.::|.:    ||:|:.:.|.::...|:    :|:...:|.|:.:                 .|
Yeast    29 DDANYSVL----DLYDDDDEGDDSSTVER----KEILTTRELEKAK-----------------AF 68

  Fly   809 QNIDNMEPLRLQENCFADSETENDLGLGLDSSGNILMLSIKSSPSTSSYETVGNEFLDMAEAKLE 873
            .::...:|             ||....|....|..:        |...|:....|:....|.:.:
Yeast    69 TSLIMADP-------------ENFDRYGFSKKGYFI--------SQEEYDKWWTEYNRYTERRKK 112

  Fly   874 EEEPPGQLSKFHSADDVRLDNQDEEESSQPATAVIITEAASLDALDDDPTE-------EFTSRKT 931
            :.|            :..|.|:.|..:..|......|:..|.......|.|       .|...:.
Yeast   113 KWE------------NFLLKNKIELHNDNPLVYPARTDELSKFVRKGIPAEWRGNAWWYFAGGQR 165

  Fly   932 SLMSPLNEDITVVASLDALQEPKSACVSPASSNGGVYSVELLEQFGLNLHRIEKDVQRCDRNYWY 996
            .|          .|::......||.|...|.|             |.::..||:|:.|...:..:
Yeast   166 QL----------DANVGVYDRLKSDCREGAVS-------------GKDMEAIERDLYRTFPDNIH 207

  Fly   997 FANEN--------LDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFCKLMERM 1053
            |..|:        :..||.|:..:......:||.|.|..||..||:..::|    ..|..|:...
Yeast   208 FHKESFQNGEPAIIRSLRRVLMAFSVYDKTIGYCQSMNFLVGLLLLFMEEE----KAFWMLVIIT 268

  Fly  1054 IENFPSGGAMDMHFANMRSLIQILDSEMY----------DLMDSNGDYTHF--------YFC--- 1097
            .:..|.....|:..||:...:.:|..:.|          ..|:.||.....        |.|   
Yeast   269 GKYLPGVYESDLEGANVDQGVLVLCIKEYLPEIWSHIESSYMNGNGSTDQISGPASGEEYLCRLP 333

  Fly  1098 ------YRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLE 1142
                  ..||:..|...:..:.....|:.::    ....||:..:||.:|:
Yeast   334 TLTLCTASWFMSCFVGVVPIETTLRIWDCLF----YEESHFLFKVALGILK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 41/211 (19%)
MSB4NP_014529.1 COG5210 <53..461 CDD:227535 71/413 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.