DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and GYP6

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_012491.3 Gene:GYP6 / 853406 SGDID:S000003580 Length:458 Species:Saccharomyces cerevisiae


Alignment Length:336 Identity:63/336 - (18%)
Similarity:118/336 - (35%) Gaps:101/336 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   893 DNQDEEESSQPATAVIITEAASLDALDDDPTEEFTSRKTSLMSPLNEDITVVASLDALQEPKSAC 957
            ||.||..::.....|:.:..:|...:     ...|..:.....||::|          .:.....
Yeast    81 DNYDENHNANVPKRVLHSNVSSSVGI-----RRLTPVEAVEKHPLSDD----------NDKTKGS 130

  Fly   958 VSPASSNGGVYSVELLEQFGLNLHRI-------EKDVQRCDRNYWYFANENLDKLRNVISTYVWE 1015
            :|..|....:...|.||...|:|.||       |..|....|...|          |.:..:..|
Yeast   131 LSKGSDEKPLTLRETLEIIDLDLSRIMLDDIFQEPKVHAQMRQLLY----------NYLLIHQSE 185

  Fly  1016 HLDVGYMQGMCDLVAPL-LVIFDDESLSYS-------CFCKLMERMIENFPSGGAMDMHFANMRS 1072
            ||.  |.||..::::.: |.::....|..:       .|.|||.:          ::..|.|..:
Yeast   186 HLQ--YKQGFHEILSVIYLQLYHGTDLDNTDLQNVLIIFNKLMNQ----------IEPIFYNEEN 238

  Fly  1073 LIQILDSEMY---------DLMD--------------SNGD---YTHFYFCYRWFLLDFKRELVY 1111
            ||. .|..::         ||..              .|.|   :::..:..||..|.|.|||..
Yeast   239 LIN-WDKRVFTKIFRICLPDLFSKVFYQPPKTGSGKKKNVDHLIHSNLIWLIRWTRLLFLRELPL 302

  Fly  1112 DDVFATWEVIWAAKHIASGHF---------VLFLALALLETYRDII-------LSNSMDFTDVIK 1160
            ..|...|:      |:.:.::         ::.|.|::.:...:::       .:|:.:|.::|.
Yeast   303 KYVLIVWD------HVLTFNYPLDIFIACTIITLLLSIYDELHELVSQGDYEHTNNNDEFVELIL 361

  Fly  1161 FFNEMAERHNA 1171
            .|.::.|:.:|
Yeast   362 HFKKIFEKEDA 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 44/217 (20%)
GYP6NP_012491.3 TBC <145..336 CDD:214540 44/219 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.