DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and AT4G28550

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_194584.3 Gene:AT4G28550 / 828973 AraportID:AT4G28550 Length:424 Species:Arabidopsis thaliana


Alignment Length:244 Identity:60/244 - (24%)
Similarity:112/244 - (45%) Gaps:48/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   975 QFGLNLHRIEKDVQRCDRNYWYFANE-NLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDD 1038
            |:.|.|.:|..||.|.||...::.:| |..:|.:::|.|.|.:.|:||:|||.|:.:|::::.:|
plant   162 QWMLVLSQIGLDVVRTDRYLCFYESESNQARLWDILSIYTWLNPDIGYVQGMNDICSPMIILLED 226

  Fly  1039 ESLSYSCFCKLMERMIENF---PSGGAMDMHFANMRSLIQILDSEMYD-LMDSNGDYTHFYFCYR 1099
            |:.::.||.:.|.|:.|||   .:...:......:..:|:.:|..::. |.|.:|.  .:.|..|
plant   227 EADAFWCFERAMRRLRENFRTTATSMGVQTQLGMLSQVIKTVDPRLHQHLEDLDGG--EYLFAIR 289

  Fly  1100 WFLLDFKRELVYDDVFATWEVIWA-----------------------------------AKHIAS 1129
            ..::.|:||..:.|....||::||                                   .|:|.|
plant   290 MLMVLFRREFSFLDALYLWELMWAMEYNPNKFASYEEPQNMNNSSGQDPRLLKQYGKFERKYIKS 354

  Fly  1130 GH------FVLFLALALLETYRDIILSNSMDFTDVIKFFNEMAERHNAQ 1172
            |.      ..:|:..::|||....:|..:....||::....:|...:|:
plant   355 GQNEQHNTLAVFVVASVLETKNKRLLKEAKGLDDVVQILGGIAGNLDAR 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 47/188 (25%)
AT4G28550NP_194584.3 RabGAP-TBC 163..313 CDD:366170 44/151 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.