| Sequence 1: | NP_728346.2 | Gene: | CG1695 / 33046 | FlyBaseID: | FBgn0031116 | Length: | 1192 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_078958.2 | Gene: | TBC1D17 / 79735 | HGNCID: | 25699 | Length: | 648 | Species: | Homo sapiens |
| Alignment Length: | 207 | Identity: | 71/207 - (34%) |
|---|---|---|---|
| Similarity: | 114/207 - (55%) | Gaps: | 7/207 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 983 IEKDVQRCDR-NYWYFANEN--LDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYS 1044
Fly 1045 CFCKLMERMIENF-PSGGAMDMHFANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRE 1108
Fly 1109 LVYDDVFATWEVIWAAKHIASGHFVLFLALALLETYRDIILSNSMDFTDVIKFFNEMAERHNAQS 1173
Fly 1174 ILQLSRSLVLQL 1185 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1695 | NP_728346.2 | RUN | 63..237 | CDD:280855 | |
| PH_RUTBC | 310..485 | CDD:275431 | |||
| SRP68-RBD | <648..>713 | CDD:304552 | |||
| TBC | 947..1124 | CDD:214540 | 58/144 (40%) | ||
| TBC1D17 | NP_078958.2 | DUF3548 | 5..218 | CDD:192931 | |
| Required for interaction with OPTN. /evidence=ECO:0000269|PubMed:22854040 | 218..309 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 240..259 | ||||
| TBC | 307..542 | CDD:214540 | 64/169 (38%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 594..648 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5210 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||