DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and TBC1D3H

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:XP_011523474.1 Gene:TBC1D3H / 729877 HGNCID:30708 Length:610 Species:Homo sapiens


Alignment Length:308 Identity:65/308 - (21%)
Similarity:92/308 - (29%) Gaps:117/308 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 PILELGRSSPRRKHLGSCSTTG--SSDCSSKSL-SIDQSSCETPLIQASQSTSIELVCSTMRRQI 556
            |.||..|:||   ..||....|  .:.|||.:| .:..|..|.|.:.|.::..|        |:.
Human    79 PELERDRASP---FWGSAPRLGPLQAPCSSSALPGLPYSETELPPLTAREAKQI--------RRE 132

  Fly   557 ISRAFYGWLAYCRHLSTVRTHLSGLVNGRIMPDLAADEEGLTRGKWLAMHEDGVVTGDLELY--- 618
            |||                                       :.||:.|      .||.|.|   
Human   133 ISR---------------------------------------KSKWVDM------LGDWEKYKSS 152

  Fly   619 -RLV--YFGGVEPELRKEVWPYLL----------GHYDFGSTPEERKKQDETC------------ 658
             :|:  .:.|:...:|..:|..||          |.|..  ..|:.|:..|..            
Human   153 RKLIDRAYKGMPMNIRGPMWSVLLNTEEMKLKNPGRYQI--MKEKGKRSSEHIQRIDRDISGTLR 215

  Fly   659 KHY-----YETTMSEWLAVEAIVRQREKEK---------TALAVAKLSAEQARLAANATSSSNPH 709
            ||.     |.|...|.|.:.....:...|.         .||.:..|..|.|..|.        .
Human   216 KHMFFRDRYGTKQRELLHILLAYEEYNPEVGYCRDLSHIAALFLLYLPEEDAFWAL--------V 272

  Fly   710 QKLANGSQQLQLEHG------NGEEDQENLVLDEGENDVFDDNDFSDI 751
            |.||:....||..|.      .|.:||:..|:...:.......|..|:
Human   273 QLLASERHSLQGFHSPNGGTVQGLQDQQEHVVATSQPKTMGHQDKKDL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552 17/90 (19%)
TBC 947..1124 CDD:214540
TBC1D3HXP_011523474.1 TBC 160..373 CDD:214540 35/171 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.