DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and Tbc1d10b

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_653105.3 Gene:Tbc1d10b / 68449 MGIID:1915699 Length:798 Species:Mus musculus


Alignment Length:384 Identity:80/384 - (20%)
Similarity:129/384 - (33%) Gaps:118/384 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   815 EPLRLQENCFADSETENDLGLGLDSSGNILMLSIKSSPSTSSYETVGNEFLDMAEAKLEEEEPPG 879
            ||:   || |.|..:.:.||.|:.....       .:|.|.||    .:.:.:....|  |..|.
Mouse   224 EPV---EN-FQDLGSTSSLGPGISGPRG-------QAPDTLSY----LDSVSLMSGTL--ESLPD 271

  Fly   880 QLSKFHSADDVR---LDNQDEE------------ESSQPATAVIITEAASLDALDDDPTEEFTSR 929
            .:|...|..::.   |...|:.            |||.|.......|...|:...:  .:::.||
Mouse   272 DVSSMGSDSEINGMALRKTDKYGFLGGSQYSGSLESSIPVDVARQRELKWLEMFSN--WDKWLSR 334

  Fly   930 KTSLMSPLNEDITVVASLDALQEPKSACVS--PASSNGGVY-----SVELLEQFGLN-------- 979
            :                   .|:.|..|..  |:|.....:     |.|||||   |        
Mouse   335 R-------------------FQKVKLRCRKGIPSSLRAKAWQYLSNSKELLEQ---NPGKFEELE 377

  Fly   980 --------LHRIEKDVQRCDRNYWYFA---NENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLL 1033
                    |..||||:.|....:..||   ......|..::..|.....|.||.|....:.|.||
Mouse   378 RAAGDPKWLDVIEKDLHRQFPFHEMFAARGGHGQQDLYRILKAYTIYRPDEGYCQAQAPVAAVLL 442

  Fly  1034 VIFDDESLSYSCFCKLMERMIENFPSGGAM------DMHFANMRSLI---------QILDSEMYD 1083
            :....|. ::.|..::.::.:..:.|.|..      ::.||.:|.:.         |.:|..:| 
Mouse   443 MHMPAEQ-AFWCLVQICDKYLPGYYSAGLEAIQLDGEIFFALLRRVSPLAHRHLRRQRIDPVLY- 505

  Fly  1084 LMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-LALALL 1141
                         ...||:..|.|.|.:..|...|::.:     ..|..::| :||.||
Mouse   506 -------------MTEWFMCIFARTLPWASVLRVWDMFF-----CEGVKIIFRVALVLL 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 46/217 (21%)
Tbc1d10bNP_653105.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..211
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..250 8/35 (23%)
TBC 343..548 CDD:214540 50/227 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 618..798
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.