DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and rabgap1l2

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:XP_694092.1 Gene:rabgap1l2 / 565728 ZFINID:ZDB-GENE-070912-414 Length:320 Species:Danio rerio


Alignment Length:313 Identity:61/313 - (19%)
Similarity:119/313 - (38%) Gaps:79/313 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   675 IVRQREKEK--TALAVAKL-----SAEQARLAANATSSSNPHQKLANGSQQLQ-----LEHGNGE 727
            |:.|..:|:  .:|.|..|     .:::.:|..|.....:|..|....:::||     ||..|.:
Zfish    15 IIDQMSEEEILASLVVESLPKQVVPSKKQKLRDNQEQPEDPLDKYERENRKLQETSLRLEQENDD 79

  Fly   728 EDQENL--------VLDEGENDVFDDNDFSDISDPGDLFDEPELGQEAEEQEQSNLEEEVFEKQE 784
            ..|:.:        .||:.|:.|  |....::|....|....|..:..:|:|.|.| :|:|.|:.
Zfish    80 LAQKLVTSKIALRNALDQTEDQV--DELTKELSKVKQLLVVTEEEKRGKEEEASQL-KEMFRKEL 141

  Fly   785 DEEDQEDHDQREMPRLSEKLVLEFQNIDNMEPLRLQENCFADSETENDLGL-------------- 835
            |:.:.:       .:.|..::.:::.|.:....:|:..   ..|.:.:|..              
Zfish   142 DKAESD-------IKRSNSIIADYKQICSQLNTKLENQ---KEEADKNLAFIKSKLQECERCSRI 196

  Fly   836 -----GLDSSGNILMLSIKSSPSTSSYETVGNEFLDMAEAKLEEEEPPGQLSKFHSADDVRLDNQ 895
                 .::|.......|.:....||..|.|.....::|:.||:..|...::.:        |::|
Zfish   197 FSVDGSIESCSESEDRSAQDEAKTSLREQVKELEKELAQTKLQMVESKCKIQE--------LEHQ 253

  Fly   896 DEEESSQPATAVIITEAASL------DALDDDPT----EEFTSRKTSLMSPLN 938
                     .||::||..:.      ..||...|    ::.:|:..|..||.|
Zfish   254 ---------KAVLMTELQAAKNTWLKKTLDSFKTAASGQQSSSQTDSAWSPNN 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552 10/44 (23%)
TBC 947..1124 CDD:214540
rabgap1l2XP_694092.1 Smc <56..>265 CDD:224117 44/238 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.