DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and si:dkeyp-19e1.3

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:XP_005170766.1 Gene:si:dkeyp-19e1.3 / 553000 ZFINID:ZDB-GENE-081104-56 Length:736 Species:Danio rerio


Alignment Length:226 Identity:52/226 - (23%)
Similarity:94/226 - (41%) Gaps:29/226 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   971 ELLEQFGLNLHRIEKDVQRCDRNYWYFANE---NLDKLRNVISTYVWEHLDVGYMQGMCDLVAPL 1032
            |..:::...:.:|:.||.|..||:..|...   ....|.:|::.|...:.:|.|.|||..:.|.|
Zfish   131 EQAKRYSTEIKQIDLDVNRTFRNHIMFMERFGVKQQALFHVLAAYSVYNTEVSYCQGMSQIAAIL 195

  Fly  1033 LVIFDDESLSYSCFCKLMER-------MIENFPSGGAMDMHFANMRS-LIQILDSEMYDLMDSNG 1089
            |:..::|...::....|..:       .|..||......:|...:.| |:..|.:.:.....|.|
Zfish   196 LMYMNEEDAFWALSQLLTNQKHAMHGFFIPGFPKLHRFQVHHDKILSKLLSKLRNHLEKEQMSTG 260

  Fly  1090 DYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVL-FLALALLETYRDIILSNSM 1153
            .||     .:|||..|.....:......|::     :|..|..|| .:|..||:.::..:|..|:
Zfish   261 IYT-----TKWFLQCFIDRTPFTLTLRLWDI-----YILEGEKVLTAMAYTLLKLHKKHLLKLSL 315

  Fly  1154 DFTDVIKFFNEMAERHNAQSILQLSRSLVLQ 1184
            :  |:.:|..|     ...|...:|..:|::
Zfish   316 E--DLREFLQE-----RTASSFNMSDDVVIE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 37/163 (23%)
si:dkeyp-19e1.3XP_005170766.1 TBC 96..301 CDD:214540 42/179 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.