DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and grtp1

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_001005632.1 Gene:grtp1 / 448089 XenbaseID:XB-GENE-950226 Length:342 Species:Xenopus tropicalis


Alignment Length:217 Identity:52/217 - (23%)
Similarity:98/217 - (45%) Gaps:37/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   966 GVYSVELLEQFGLNLHRIEKDVQRCDRNYWYFANENLDK-LRNVISTYVWEHLDVGYMQGMCDLV 1029
            |..:.:||:....:|:|...|.....:|    ||.:|.| |.||:..|...:..|||.|||..:.
 Frog   106 GEKNPKLLDLVITDLNRTFPDNVLFQKN----ANPSLQKDLYNVLVAYGQHNKTVGYCQGMNFIA 166

  Fly  1030 APLLVIFDDESLSYSCFCKLMERMIENFPSGGAM-----------DMHFANMRSLIQILDSE--M 1081
            ..|:::..||..::.....|:.:::.::.| .||           |:....:.|:.|::::.  |
 Frog   167 GYLILVTKDEEKAFWLMDALIGQILPDYYS-PAMTGLKTDQEVLGDLVKKKIPSVAQLIETHGVM 230

  Fly  1082 YDLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-LALALLETYR 1145
            :.|:.|           |||:..|...|..:.|...|:.::     ..|..|:| :||.|::..:
 Frog   231 WTLLVS-----------RWFICLFIDILPVETVLRIWDCLF-----FEGSKVIFRVALTLIKQSQ 279

  Fly  1146 DIILSNSMDFTDVIKFFNEMAE 1167
            ..|: .:.:|.|:...|.|:.:
 Frog   280 ASIM-EARNFPDICDKFKEITK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 41/171 (24%)
grtp1NP_001005632.1 TBC 69..283 CDD:214540 47/197 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.