DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and CG5745

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_650941.3 Gene:CG5745 / 42498 FlyBaseID:FBgn0038855 Length:546 Species:Drosophila melanogaster


Alignment Length:365 Identity:77/365 - (21%)
Similarity:134/365 - (36%) Gaps:66/365 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   850 SSPSTSSYETVGNEFLDMAEAKLEEEEPPG--QLSKFHSADDVRLDNQDEEESSQPATAVIITEA 912
            ||.||...:.......|..|.:......||  ||.|..|      :.||.|..         |:.
  Fly   173 SSSSTDDCKEDRRSLPDSNENRSRLRNYPGRPQLQKISS------NCQDSEYE---------TKI 222

  Fly   913 ASLDALDDDPTEEFTSRKTSLMSPLNEDITVVA--SLDALQEPKS---ACVSPASSNG------G 966
            .....:.|.|..:..:.|....|.:...:..|:  .|.....|.|   ..|..:...|      .
  Fly   223 EKFQVVLDSPQLDLVALKKISWSGVPRKMRAVSWRLLSKYLPPSSERRMAVLESKRQGYQDLRHN 287

  Fly   967 VYSVELLEQFGLNLHR-IEKDVQRCDRNYWYFANENLDKLRNVISTYVW--EHLDVGYMQGMCDL 1028
            .:.|:..::...:.:| |..||.|.:.....|..:.:.::...| .::|  .|...||:||:.||
  Fly   288 YFRVDSQDETQQDTYRQIHIDVPRMNPQIPLFQQQLVQEMFERI-LFIWAIRHPASGYVQGINDL 351

  Fly  1029 VAPLLVIFDDESL-------------------------SYSCFCKLMERMIEN--FPSGGAMDMH 1066
            |.|..::|..|:|                         |:.|..|.::.:.:|  |...|..: .
  Fly   352 VTPFFIVFLQEALTPNTDLEKYDMSTLPEETRNIIEADSFWCLSKFLDCIQDNYIFAQLGIQE-K 415

  Fly  1067 FANMRSLIQILDSEMYDLMDSNG-DYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASG 1130
            ...::.|||.:|..::..:.::| ||..|.|  ||......|||........|:. :.|:.....
  Fly   416 VNQLKDLIQRIDVNLHRHLQAHGVDYLQFSF--RWMNNLLTRELPLHCTIRLWDT-YLAESDGFA 477

  Fly  1131 HFVLFLALALLETYRDIILSNSMDFTDVIKFFNEMAERHN 1170
            .|.|::..|.|..:::.::..: ||..::.....: ..||
  Fly   478 LFHLYVCAAFLLHWKEQLMQQN-DFQGLMLLLQNL-PTHN 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 47/216 (22%)
CG5745NP_650941.3 TBC 243..496 CDD:214540 54/257 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456626
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.