DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and CG5916

DIOPT Version :10

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_650524.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster


Alignment Length:242 Identity:55/242 - (22%)
Similarity:102/242 - (42%) Gaps:54/242 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   969 SVELLEQFGLNLHRIEKDVQRCDRNYWYFANENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLL 1033
            |::|...|..|:|   .|:::             .:|.|::..|...:.||||.||:..:...||
  Fly   115 SIDLPRTFPDNIH---FDMKK-------------QRLYNILIAYAHHNRDVGYCQGLNYIAGLLL 163

  Fly  1034 VIFDDESLSYSCFCKLMERMIENFPSGGAMDMHFANMRSLIQILDSEMYDL-----------MDS 1087
            ::.|||..|:    .|::.::||.    ....|..||.:|::.| :...:|           :|:
  Fly   164 IVTDDEEKSF----WLLKHIVENI----VPQYHSHNMANLLRDL-AVFRELVIRRIPAVNRHVDN 219

  Fly  1088 NGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-LALALLETYRDIILSN 1151
            .| ..:.....:||:..|...|..:.|...|:.::     |.|:.::| .||.:..|:::.||..
  Fly   220 LG-LPYPVIASKWFICIFAEVLPVETVLRIWDCVF-----AEGYKIVFRAALTMFVTHKNAILGC 278

  Fly  1152 SMDFTDVIKFFNEMAERHN----------AQSILQLSRSLVLQLQTI 1188
            . |...:...|.:...:.|          |...|:|.||.:..|:.:
  Fly   279 D-DIAALANLFRDTMIQDNIVTDCHGFVEAMFSLRLKRSELESLRKV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN_SGSM1_like 39..233 CDD:439049
PH_RUTBC 310..485 CDD:275431
TBC 947..1124 CDD:214540 38/165 (23%)
CG5916NP_650524.1 TBC 67..276 CDD:214540 44/191 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.