DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and sgsm3

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_998495.1 Gene:sgsm3 / 406635 ZFINID:ZDB-GENE-040426-2635 Length:755 Species:Danio rerio


Alignment Length:260 Identity:57/260 - (21%)
Similarity:100/260 - (38%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   949 ALQEPKSACVS-----PASSNGGVYSVELLEQFGLNLHRIEKDVQR------CDRNYWYFANENL 1002
            |||:.:::.:|     ..|||....:.:          :||||:.|      |   :....:..:
Zfish   131 ALQKKRTSDISYREIVKNSSNDDTTAAK----------QIEKDLLRTMPTNAC---FNTLTSVGV 182

  Fly  1003 DKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFCKLMERMIENFPSGGAMDMHF 1067
            .|||.|:....|.:.|:||.||...:|:.||:..::|...: ..|.|:|.::.  ||      :|
Zfish   183 PKLRRVLRGLAWLYPDIGYCQGTGMVVSCLLLFLEEEDALW-MMCALIEDLLP--PS------YF 238

  Fly  1068 A--------NMRSLIQILDSEM--YDLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIW 1122
            :        :.|.|.|::...:  .|.:....|.........|||..|...:....:...|::::
Zfish   239 SSTLLGVQTDQRVLRQLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIRILLRIWDLLF 303

  Fly  1123 AAKHIASGHFVLF-LALALLETYRDIILSNSMDFTDVIKFFNEMAERHNAQSILQLSRSLVLQLQ 1186
                 ..|..||| :.|.:|:...|                 |:....|:.||......|..||:
Zfish   304 -----YEGSMVLFQVTLGMLKIKED-----------------ELVSSENSASIFNTLSDLPSQLE 346

  Fly  1187  1186
            Zfish   347  346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 43/195 (22%)
sgsm3NP_998495.1 TBC 112..326 CDD:214540 51/238 (21%)
SH3_SGSM3 488..540 CDD:212747
RUN 567..720 CDD:280855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.