DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and Tbc1d2

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:XP_006538109.1 Gene:Tbc1d2 / 381605 MGIID:2652885 Length:923 Species:Mus musculus


Alignment Length:615 Identity:122/615 - (19%)
Similarity:228/615 - (37%) Gaps:143/615 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   646 STPEER-KKQDETCKHYYE------TTMSEWLAVE----AIVRQREKEKTALAVAKLSAEQARLA 699
            |.|.:: |:|..|...:.:      |...:..|:|    .:.::.:.:|..:.:...:.|.|:..
Mouse   282 SGPTQKPKRQSNTFPFFSDGLARSRTAQEKVAALEQQVLMLTKELKSQKELVIILHKALEAAQQE 346

  Fly   700 ANATSS--------------SNPHQKLANGSQQLQ--------LEHGNGEEDQENLVLDEGENDV 742
            ..|:|:              .:..:::|..:|:::        |.|..|..:|:...|.:....:
Mouse   347 KRASSAYLAATEDRDRLELVRHKVRQIAELNQRVEALEQGRERLAHEAGLREQQVQALQQHVQLL 411

  Fly   743 FDDND-------------FSDISDPGDLFDEPELGQEAEEQEQSNLEEEVFEKQEDEEDQEDHD- 793
            .|.|.             ..|::.|.|..:...|.|: |..|....:.|.:..|....:.|.|. 
Mouse   412 MDKNHAKQQVICKLTQKLTEDLAQPADATNGDFLSQQ-ERMEHLKDDMEAYRTQNRFLNSEIHQV 475

  Fly   794 --------QREMPRLSEKLVLEFQNIDNMEPL-----RLQENCFADSETENDLGLGL-------- 837
                    ::|...|::...|:.:|.......     ||||...|::....:|...|        
Mouse   476 TKIWRKVAEKEKALLTKCAYLQARNCQVESKYLAGLRRLQEAAGAEAGDFPELLQQLIQEALQWE 540

  Fly   838 ----DSSGNILMLSIKSSPSTSSYETVGNEFLDMAEAKLEEEEPPGQLSKFHSADDVRLDNQDEE 898
                ||.|        .|| .|.|:..|  ||.:.:.::|:.:   .|:|. .|.:||..:....
Mouse   541 AGEADSVG--------LSP-VSEYDDYG--FLTVPDYEMEDLK---LLAKI-QALEVRSHHLLAH 590

  Fly   899 ES-SQP-----ATAVIITEAASLDAL--DDDPTEE--------FTSRKTSLMSPLNEDITVVASL 947
            |: .:|     ||...:|.:|.|..|  ...|.|.        ...|...|.:|        ...
Mouse   591 EAVERPLRDRWATLTELTPSAELKQLLRAGVPREHRPRVWRWLVHRRVRHLQAP--------GCY 647

  Fly   948 DALQEPKSACVSPASSNGGVYSVELLEQFGLNLHRIEKDVQR---CDRNYWYFANENLDKLRNVI 1009
            ..|.....||..||:                  .:||.|:.|   .::::....:...||||.|:
Mouse   648 QELLARGRACEHPAA------------------RQIELDLNRTFPTNKHFTCPTSSFPDKLRRVL 694

  Fly  1010 STYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFCKLMERMIENFPSGGAMDMHFANMRSLI 1074
            ..:.|::..:||.||:..|.|..|::.:||..::.|...::|.::........:.....:.|.|.
Mouse   695 LAFSWQNPTIGYCQGLNRLAAIALLVLEDEESAFWCLVAIVETILPAEYYSKTLTASQVDQRVLQ 759

  Fly  1075 QILDSEMYDLMDSNGDY--THFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-L 1136
            .:|..::..|....|.:  ......:.|||:.|...|:.|.:...|:..     :..|..|:| .
Mouse   760 DLLSEKLPRLTAHLGQHRVDLSLITFNWFLVVFADSLISDILLRVWDAF-----LYEGTKVVFRY 819

  Fly  1137 ALALLETYRDII--LSNSMDFTDVIKFFNE 1164
            |||:.:...:.|  |.:|::....::||.:
Mouse   820 ALAIFKYNEEAILQLQDSLEIYQYLRFFTK 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552 12/89 (13%)
TBC 947..1124 CDD:214540 38/181 (21%)
Tbc1d2XP_006538109.1 PH_TBC1D2A 45..146 CDD:269966
PRK14951 <192..404 CDD:237865 19/121 (16%)
COG4913 <300..>565 CDD:227250 49/276 (18%)
TBC 620..832 CDD:214540 49/242 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.