DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and CG8155

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_611029.3 Gene:CG8155 / 36698 FlyBaseID:FBgn0034009 Length:1098 Species:Drosophila melanogaster


Alignment Length:213 Identity:70/213 - (32%)
Similarity:102/213 - (47%) Gaps:28/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   917 ALDDDPTEEFTSRKTSLMSPLNEDITVVASLDALQEPKSACVSPASSNGGVYSVELLEQFGLNLH 981
            |||.....||..||:.             ....|::...|.|...|..|.:..|..:        
  Fly   251 ALDGHQRMEFMRRKSE-------------QYCRLRDTWKAAVKRGSVAGELAYVTSM-------- 294

  Fly   982 RIEKDVQRCDRNYWYFA----NENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLS 1042
             ::|||.|.||.:.::|    |:|:..|.|:::||...|..|.|.|||.|:.:||||..:||:.:
  Fly   295 -VKKDVLRTDRLHPFYAGSDDNQNIAALFNILTTYALNHPSVSYCQGMSDIASPLLVTMNDEAQA 358

  Fly  1043 YSCFCKLMERMIENFPSGG-AMDMHFANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFK 1106
            |.|||.:|.||..||...| ||...||::...:...|.|.::.:.|. ......|||||.||:.|
  Fly   359 YICFCAIMSRMRGNFMLDGIAMTQKFAHLTEALSFYDPEFWEYLKSQ-QADDLLFCYRWLLLELK 422

  Fly  1107 RELVYDDVFATWEVIWAA 1124
            ||..::|.....||.|::
  Fly   423 REFPFEDALRMLEVQWSS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 63/181 (35%)
CG8155NP_611029.3 TBC 225..439 CDD:214540 69/210 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456618
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.