DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and Tbc1d10b

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_001102391.1 Gene:Tbc1d10b / 365372 RGDID:1309191 Length:795 Species:Rattus norvegicus


Alignment Length:380 Identity:83/380 - (21%)
Similarity:121/380 - (31%) Gaps:118/380 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   825 ADSETENDLGLGLDSS-GNILMLSIKSSPSTSSYETVGNEFLDMAEAKLEEEEPPGQLSKFHSAD 888
            |...|||...||..|| |..:......:|.|.||       ||.....      .|.|...  .|
  Rat   219 APETTENFQDLGSTSSLGPGISGPRGQAPDTLSY-------LDSVSLM------SGTLESL--TD 268

  Fly   889 DVRLDNQDEE------------------------ESSQPATAVIITEAASLDALDDDPTEEFTSR 929
            ||.....|.|                        |||.|.......|...|:...:  .:::.||
  Rat   269 DVSSVGSDSEINGLALRKTDKYGFLGGSQYSGSLESSIPVDVARQRELKWLEMFSN--WDKWLSR 331

  Fly   930 KTSLMSPLNEDITVVASLDALQEPKSACVS--PASSNGGVY-----SVELLEQFGLN-------- 979
            :                   .|:.|..|..  |:|.....:     |.|||||   |        
  Rat   332 R-------------------FQKVKLRCRKGIPSSLRAKAWQYLSNSKELLEQ---NPGKFEELE 374

  Fly   980 --------LHRIEKDVQRCDRNYWYFA---NENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLL 1033
                    |..||||:.|....:..||   ......|..::..|.....|.||.|....:.|.||
  Rat   375 RAPGDPKWLDVIEKDLHRQFPFHEMFAARGGHGQQDLYRILKAYTIYRPDEGYCQAQAPVAAVLL 439

  Fly  1034 VIFDDESLSYSCFCKLMERMIENFPSGGAMDMHFANMRSLIQILDSEM-YDLMDSNGDYTHFY-- 1095
            :....|. ::.|..::.::.:..:.|.|.         ..|| ||.|: :.|:.......|.:  
  Rat   440 MHMPAEQ-AFWCLVQICDKYLPGYYSAGL---------EAIQ-LDGEIFFALLRRASPLAHRHLR 493

  Fly  1096 --------FCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-LALALL 1141
                    :...||:..|.|.|.:..|...|::.:     ..|..::| :||.||
  Rat   494 RQRIDPVLYMTEWFMCIFARTLPWASVLRVWDMFF-----CEGVKIIFRVALVLL 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 47/213 (22%)
Tbc1d10bNP_001102391.1 TBC 340..545 CDD:214540 51/223 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.