DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and Tbc1d10c

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_001075449.1 Gene:Tbc1d10c / 361697 RGDID:1311490 Length:446 Species:Rattus norvegicus


Alignment Length:262 Identity:58/262 - (22%)
Similarity:90/262 - (34%) Gaps:64/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   963 SNGGVYSVEL---------LEQFGLNLHRIEKDVQRCDRNYWYFANENL---------DKLRNVI 1009
            :|.|.|. ||         :|..|.:|||             .|....:         ..|..|:
  Rat   114 NNPGTYQ-ELAVAPGDPQWMETIGRDLHR-------------QFPLHEMFVSPQGHGQQGLLQVL 164

  Fly  1010 STYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFCKLMERMIENF--PSGGAMDMHFANMRS 1072
            ..|.....:.||.|....:.|.||:....|. ::.|..::.|..:..:  |...|:.:......:
  Rat   165 KAYTLYRPEQGYCQAQGPVAAVLLMHLPPEE-AFWCLVQICEVYLPGYYGPHMEAVQLDAEVFMA 228

  Fly  1073 LIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-- 1135
            |::.|...:|..:...|.....|. ..|||..|.|.|.:..|...|:..     ::.|..|||  
  Rat   229 LLRRLLPRVYKHLQQVGVGPLLYL-PEWFLCLFTRSLPFPIVLRIWDAF-----LSEGAKVLFRA 287

  Fly  1136 ------LAL----------ALLETYRDIILSNSMDFTDVIKFFNEMAERHN-AQSILQLSRSLVL 1183
                  |||          .||||...:.........:.:    .|::.|| |.|...|.|.:.:
  Rat   288 GLTLMRLALGTVEQRTACPGLLETLGALRTIPPTQLQEEV----FMSQVHNVALSERDLQREIRI 348

  Fly  1184 QL 1185
            ||
  Rat   349 QL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 38/180 (21%)
Tbc1d10cNP_001075449.1 TBC 89..294 CDD:214540 42/200 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.