DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and Tbc1d10a

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_001015022.1 Gene:Tbc1d10a / 360968 RGDID:1311641 Length:505 Species:Rattus norvegicus


Alignment Length:302 Identity:58/302 - (19%)
Similarity:106/302 - (35%) Gaps:68/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   886 SADDVRLDNQDEEESSQPATAV-----IITEAASLDALDDDPTEEFTSRKTSLMSPLNEDITVVA 945
            :||::.....|.|.:......:     |:....:..||::.|.|....|::..:..||       
  Rat    34 TADELSSLGSDSEANGFAERRIDKFGFIVGSQGAEGALEEVPLEVLRQRESKWLDMLN------- 91

  Fly   946 SLDALQEPKSACVS-------PASSNGGVY------SVELLEQFG----LN--------LHRIEK 985
            :.|.....|...:.       |.|..|..:      .|:|.:..|    |:        |..||:
  Rat    92 NWDKWMAKKHKKIRLRCQKGIPPSLRGRAWQYLSGGKVKLQQNPGKFDELDMSPGDPKWLDVIER 156

  Fly   986 DVQRCDRNYWYFAN---ENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFC 1047
            |:.|....:..|.:   .....|..|:..|.....:.||.|....:.|.||:....|. ::.|..
  Rat   157 DLHRQFPFHEMFVSRGGHGQQDLFRVLKAYTLYRPEEGYCQAQAPIAAVLLMHMPAEQ-AFWCLV 220

  Fly  1048 KLMERMIENFPSGGAMDMHFANMRSLIQILDSE-MYDLMDSNGDYTH----------FYFCYRWF 1101
            ::.|:.:..:         ::.....|| ||.| ::.|:.......|          ..:...||
  Rat   221 QVCEKYLPGY---------YSEKLEAIQ-LDGEILFSLLQKVSPVAHKHLSRQKIDPLLYMTEWF 275

  Fly  1102 LLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-LALALLE 1142
            :..|.|.|.:..|...|::.:     ..|..::| :.|.||:
  Rat   276 MCAFARTLPWSSVLRVWDMFF-----CEGVKIIFRVGLVLLK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 41/215 (19%)
Tbc1d10aNP_001015022.1 TBC 110..313 CDD:214540 44/219 (20%)
VCX_VCY 404..>501 CDD:291884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.