DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and TBC1D26

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_001375394.1 Gene:TBC1D26 / 353149 HGNCID:28745 Length:468 Species:Homo sapiens


Alignment Length:265 Identity:47/265 - (17%)
Similarity:103/265 - (38%) Gaps:59/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   828 ETEND-LGLGLDSSGNILMLSIKSSPSTSSYETVGNEFLDMAE-----AKLEEEEPPGQLSKFH- 885
            |.:.| ..|.....|||::...:......:...:|:|.:|:.:     ..:.|.|.|      | 
Human     2 EMDGDPYNLPAQGQGNIIITKYEQGHRAGAAVDLGHEQVDVRKYTNNLGIVHEMELP------HV 60

  Fly   886 SADDVRLDNQDEEESSQPATAVIITEAASLDALDDDPTEEFTSR--KTSLMSPLNEDITVVASLD 948
            ||.:|:...::.:.:::       .:....|......|::.:.|  |...::......:::..:|
Human    61 SALEVKQRRKESKRTNK-------WQKMLADWTKYRSTKKLSQRVYKVIPLAVRGRAWSLLLDID 118

  Fly   949 ALQEPKSACVSPASSNGGVYSVELLEQFGLN----LHRIEKDVQRCDRNYWYFANE---NLDKLR 1006
            .::          |.|.|.|.|  :::.|..    :|.|:.||....:.:..|...   ...:|.
Human   119 RIK----------SQNPGKYKV--MKEKGKRSSRIIHCIQLDVSHTLQKHMMFIQRFGVKQQELC 171

  Fly  1007 NVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDE----------SLSYSCFCKLMERMI------- 1054
            :::..|...:.:|||.:.:..:.|.||:...:|          ::.||.....:||::       
Human   172 DILVAYSAYNPEVGYHRDLSRITAILLLCLPEEDAFWALTQLLAVFYSPNTAWLERLLSHQEQVL 236

  Fly  1055 -ENFP 1058
             ::||
Human   237 HKSFP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 27/137 (20%)
TBC1D26NP_001375394.1 TBC 98..306 CDD:214540 28/156 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.