DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and CG4041

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster


Alignment Length:421 Identity:83/421 - (19%)
Similarity:153/421 - (36%) Gaps:89/421 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   802 EKLVLEFQNIDNMEPLRLQENCFADSETENDLGLGLDSSGNILMLSIKSSPSTSSYETVGNEFLD 866
            |:::|:.:. ..|:||        ..|||:          ..|:|....|.....::..|.:.  
  Fly   264 EEVLLDLKK-QKMQPL--------SPETEH----------LPLLLRCPLSQIYHLWQLAGGDV-- 307

  Fly   867 MAEAKLE----EEEP----------------PGQLSKFHSADD----VRLDNQDEEESSQPAT-- 905
            .||.|.|    .|.|                ||: |:....||    :||....:..|..||.  
  Fly   308 QAELKKEGLIRSEAPILGLPQIVRLSGASVCPGR-SQAQLMDDRVVPLRLKALLQRLSGLPAAVY 371

  Fly   906 ----------AVIITEAASLDALDDDPTEEFTSRKTSLMSPL-------NEDITVVASLDA---L 950
                      |....|...|..:..:...|:..::..|.:.|       .|.:...|::|.   |
  Fly   372 FPLLHSPRFPAHFARELQELPLVIREKDIEYQFQRVRLFARLLQGYPHTAEQLQREAAVDVPPLL 436

  Fly   951 QEPKSACVSPASSNGGVYSVELLEQFGLNLHRIEKDVQRCDRNYWYFANENLD------KLRNVI 1009
            :.|..|.:.....||....::.......: .:||.|:.||.:     .:|.|.      |||.::
  Fly   437 RGPIWAALLEVVPNGSYAKIDKFTSTSTD-RQIEVDIPRCHQ-----YDELLSSPDGHRKLRRLL 495

  Fly  1010 STYVWEHLDVGYMQGMCDLVAPLLVI-FDDESLSYSCFCKLMERMIENF--PSGGAMDMHFANMR 1071
            ..:|..|....|.||:..|.||.|.: |::|.|::....|.:.:.::.|  ....|:...:.:..
  Fly   496 KAWVTAHPQYVYWQGLDSLTAPFLYLNFNNEELAFLSLFKFIPKYLQWFFLKDNSAVIKEYLSKF 560

  Fly  1072 SLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFL 1136
            |.:......:.....::..:....|...|||..|........:...|:.:.    :....:.||:
  Fly   561 SQLTAFHEPLLAQHLASISFIPELFAIPWFLTMFSHVFPLHKILHLWDKLM----LGDSSYPLFI 621

  Fly  1137 ALALLETYRDIILSNSMDFTDVIKFFNEMAE 1167
            .:|:|...|..:|::.  |.:.|..|:::.:
  Fly   622 GIAILRQLRSTLLTSG--FNECILLFSDLPD 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 38/188 (20%)
CG4041NP_572197.4 PKc_like 45..272 CDD:304357 2/7 (29%)
TBC 432..634 CDD:214540 42/211 (20%)
RHOD_Kc 706..810 CDD:238783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.