DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and Tbc1d2

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:XP_006238118.1 Gene:Tbc1d2 / 313234 RGDID:1306860 Length:924 Species:Rattus norvegicus


Alignment Length:607 Identity:116/607 - (19%)
Similarity:224/607 - (36%) Gaps:131/607 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   649 EERKKQDETCKHYYE------TTMSEWLAVE----AIVRQREKEKTALAVAKLSAEQARLAANAT 703
            ::.|:|..|...:.:      |...:.:|:|    .:.::.:.:|..:.:...:.|.|:....|:
  Rat   284 QKPKRQSNTFPFFSDGLARSRTAQEKVVALEQQVLMLTKELKSQKELVIILHKALEAAQQEKRAS 348

  Fly   704 SS--------------SNPHQKLANGSQQLQLEHGNGEEDQENLVLDEG--ENDVFDDNDFSDIS 752
            |:              .:..:::|..:|:::..    |:|:|.||.:.|  |..|........: 
  Rat   349 SAYLAATEDRDRLELVRHKVRQIAELNQRVEAL----EQDRERLVHEAGLREQQVQALQQHVQL- 408

  Fly   753 DPGDLFDEPELGQEAEEQEQSNLEEEVFEKQEDEEDQEDHDQREMPRLSEKLVLEFQNIDNMEPL 817
                |.|:.:..|:...:....|.|::.:.|..:....|.       ||::..||... |:||..
  Rat   409 ----LMDKNQAKQQVICKLSQKLTEDLAQPQPADATNGDF-------LSQQERLEHLK-DDMEAY 461

  Fly   818 RLQENCFADSE-----------TENDLGLGLDSSGNILMLSIKSSPSTSSY--------ETVGNE 863
            |.| |.|.:||           .|.:..|    ......|..::....|.|        |..|.|
  Rat   462 RTQ-NRFLNSEIHQVTKIWRKVAEKEKAL----LTKCAYLQARNCQVESKYLAGLRRLQEAAGAE 521

  Fly   864 FLDMAEAKLEEEEPPGQLSKFHSADDVRLDNQDEEES----SQPATAV----IITEAASLD---- 916
            ..|..|...:..:...|.....::|.|.|....|.:.    :.|...|    ::.:..:|:    
  Rat   522 PGDFPELLQQLVQEALQWEAGEASDSVGLSPVSEYDDYGFLTVPDYEVEDLKLLAKIQALEVRSH 586

  Fly   917 ---ALD--DDPTEEFTSRKTSLMSPLNEDITVVASLDALQEPK---------------SACVSPA 961
               ||:  :.|..:..:..|.||........:.|.:.....|:               |.|....
  Rat   587 HLLALEAVERPLRDRWATLTELMPSAELKQLLRAGVPREHRPRVWRWLVHRRVQHLHSSGCYQEL 651

  Fly   962 SSNGGVYSVELLEQFGLNLHRIEKDVQRCDRNYWYFANENL--------DKLRNVISTYVWEHLD 1018
            .:.|.........|..|:|:|.            :..|::.        ||||.|:..:.|::..
  Rat   652 LARGRACEHPAARQIELDLNRT------------FPTNKHFTCPTSSFPDKLRRVLLAFSWQNPT 704

  Fly  1019 VGYMQGMCDLVAPLLVIFDDESLSYSCFCKLMERMIENFPSGGAMDMHFANMRSLIQILDSEMYD 1083
            :||.||:..|.|..|::.:||..::.|...::|.::........:.....:.| ::|.|.||...
  Rat   705 IGYCQGLNRLAAIALLVLEDEESAFWCLVAIVETILPAEYYSKTLTASQVDQR-VLQDLLSEKLP 768

  Fly  1084 LMDSNGDYTHF---YFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-LALALLETY 1144
            .:.::....|.   ...:.|||:.|...|:.|.:...|:..     :..|..|:| .|||:.:..
  Rat   769 RLTAHLGQRHVDLSLITFNWFLVIFADSLISDILLRVWDAF-----LYEGTKVVFRYALAIFKYN 828

  Fly  1145 RDII--LSNSMDFTDVIKFFNE 1164
            .:.|  |.:|::....::||.:
  Rat   829 EEAILRLQDSLEIYQYLRFFTK 850

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552 11/87 (13%)
TBC 947..1124 CDD:214540 39/202 (19%)
Tbc1d2XP_006238118.1 PH_TBC1D2A 44..145 CDD:269966
PH 44..137 CDD:278594
TBC 621..833 CDD:214540 45/229 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.