DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1695 and TBC1D12

DIOPT Version :9

Sequence 1:NP_728346.2 Gene:CG1695 / 33046 FlyBaseID:FBgn0031116 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_056003.1 Gene:TBC1D12 / 23232 HGNCID:29082 Length:775 Species:Homo sapiens


Alignment Length:458 Identity:94/458 - (20%)
Similarity:168/458 - (36%) Gaps:104/458 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   772 QSNLEEEVFEKQEDEEDQEDHDQREMPRLSEKLVLEFQNIDNMEPLRLQENCFADSETENDLGLG 836
            :.||::.....|::.|.:.....:..|:.|.:...||      |||                   
Human   353 RENLQKTSKIIQQEYEARTGRTCKPPPQSSRRKNFEF------EPL------------------- 392

  Fly   837 LDSSGNILMLSIKSS--PSTSSYETVGN--EFLDM-AEAKLEEEEPPGQLSKFHSADDVRLDNQD 896
               |...|:|..:.|  |:.|..|.:.:  |:.:| ||||..|      :.:.|....:..:...
Human   393 ---STTALILEDRPSNLPAKSVEEALRHRQEYDEMVAEAKKRE------IKEAHKRKRIMKERFK 448

  Fly   897 EEESSQPATAVIITEAASLDALDDDPTEEFTSRKTSL----MSP----------LNEDITVVASL 947
            :||:...|..:.|.|     .|.:......|.|...|    :.|          :..::.:...|
Human   449 QEENIASAMVIWINE-----ILPNWEVMRSTRRVRELWWQGLPPSVRGKVWSLAVGNELNITPEL 508

  Fly   948 ------DALQEPKSACVSPASSNGGVYSVELLEQFGLNLHRIEKDVQRCDRNYWYF--ANENLDK 1004
                  .|.:..||  .|..||......|.:.:: ..:|..|:.|:.|...:.:.|  .....|.
Human   509 YEIFLSRAKERWKS--FSETSSENDTEGVSVADR-EASLELIKLDISRTFPSLYIFQKGGPYHDV 570

  Fly  1005 LRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFCKLMER-------------MIEN 1056
            |.:::..|.....||||:||| ..:|.:|::..:|:.::..|..|:.:             |::.
Human   571 LHSILGAYTCYRPDVGYVQGM-SFIAAVLILNLEEADAFIAFANLLNKPCQLAFFRVDHSMMLKY 634

  Fly  1057 FPSGGAMDMHF-ANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEV 1120
            |   ...::.| .|:..|  .|..:.|.|       |...:...|....:.:.|..|.....|:|
Human   635 F---ATFEVFFEENLSKL--FLHFKSYSL-------TPDIYLIDWIFTLYSKSLPLDLACRVWDV 687

  Fly  1121 IWAAKHIASGHFVLF-LALALLETYRDIILSNSMDFTDVIKFFNEMAERHNAQSILQLSRSLVLQ 1184
            .     ...|...|| ..|.:|..|.||:|  .|||..:.:|..::.|...::.:.....::.:|
Human   688 F-----CRDGEEFLFRTGLGILRLYEDILL--QMDFIHIAQFLTKLPEDITSEKLFSCIAAIQMQ 745

  Fly  1185 LQT 1187
            ..|
Human   746 NST 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1695NP_728346.2 RUN 63..237 CDD:280855
PH_RUTBC 310..485 CDD:275431
SRP68-RBD <648..>713 CDD:304552
TBC 947..1124 CDD:214540 42/198 (21%)
TBC1D12NP_056003.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..312
TBC 481..712 CDD:214540 51/251 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.