DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mal and AT5G66950

DIOPT Version :9

Sequence 1:NP_001285493.1 Gene:mal / 33045 FlyBaseID:FBgn0002641 Length:781 Species:Drosophila melanogaster
Sequence 2:NP_201496.1 Gene:AT5G66950 / 836829 AraportID:AT5G66950 Length:870 Species:Arabidopsis thaliana


Alignment Length:299 Identity:70/299 - (23%)
Similarity:128/299 - (42%) Gaps:79/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSYRPEFSASEQSQIDA----EFSRLASNKSVYLDHAGTTLYAESQV-------TAAAEQLQRN 54
            :|.| |::.:||  ::|.    |:..|:..| |.||:.|..|::..|.       |.:..::..|
plant   119 LTMY-PKYQSSE--KVDELRNDEYFHLSLPK-VCLDYCGFGLFSYLQTVHYWDTCTFSLSEISAN 179

  Fly    55 VICNPHTC---RLTGDFVDQVRFKILEFFNTTAEDYHVIFTANATAALSLVAENFDFGSSGEF-- 114
            :  :.|..   ...|.....::.:|:::.|....:|.::||.:..:|..|:||::.|.::.:.  
plant   180 L--SNHAIYGGAEKGSIEHDIKIRIMDYLNIPENEYGLVFTVSRGSAFKLLAESYPFHTNKKLLT 242

  Fly   115 HFCQENHTSVLGMRERVRENGIYM----------------LRENEISGGKHKANGKVHEVSGKTG 163
            .|..|:. ||..|.:..:|.|..:                |::..:|..|.|.:         :.
plant   243 MFDHESQ-SVSWMGQCAKEKGAKVGSAWFKWPTLRLCSMDLKKEILSKKKRKKD---------SA 297

  Fly   164 NSLLTFSAQCNFSGYKIPLEVIEQIQIDGLAKPGKELWSSLGEKKKNMHNDYYICLDAASFVATS 228
            ..|..|..|...:|.|...:                 |.:|.::     |::::.|||.   |..
plant   298 TGLFVFPVQSRVTGSKYSYQ-----------------WMALAQQ-----NNWHVLLDAG---ALG 337

  Fly   229 PLD-----LQKYRPDYVCLSFYKIFGY-PTGVGALLVSR 261
            |.|     |..:|||::..|||::||| |||.|.||:.:
plant   338 PKDMDSLGLSLFRPDFIITSFYRVFGYDPTGFGCLLIKK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
malNP_001285493.1 PLN02724 17..753 CDD:215384 65/283 (23%)
AAT_I 29..475 CDD:302748 61/267 (23%)
MOSC_N 511..633 CDD:281474
MOSC 651..754 CDD:281471
AT5G66950NP_201496.1 PLN02724 112..>389 CDD:215384 70/299 (23%)
CsdA <698..850 CDD:223594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0520
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14237
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.