DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11710 and AT2G20410

DIOPT Version :9

Sequence 1:NP_001285492.1 Gene:CG11710 / 33044 FlyBaseID:FBgn0031115 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001324967.1 Gene:AT2G20410 / 816560 AraportID:AT2G20410 Length:339 Species:Arabidopsis thaliana


Alignment Length:147 Identity:66/147 - (44%)
Similarity:89/147 - (60%) Gaps:8/147 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 CLSMHQPWASLLVAGIKKHEGRVWYSEHRGRLWIASTSKEPHAEDIAQMEGFYKVLY---GDPDI 429
            ||:||||||||||.|||:.|||.|.|..||||||.:.||.|....|..||.||:.:|   |..||
plant    10 CLTMHQPWASLLVHGIKRIEGRSWPSPIRGRLWIHAASKVPDEATIKAMEEFYQQIYAVDGITDI 74

  Fly   430 KFPSHYPTSSLLGCVHVDSCLPQEEYR--ELYPNG---ESESPYVFVCTKPEQLNILLPVHGDHK 489
            :||.|||.|.|:|||.|..|:..:|.:  :..|.|   |.::.:.::|.||::|.|...:.|...
plant    75 QFPQHYPVSRLIGCVEVVGCVTSDELQNWDALPQGVRLEGQTNFCWLCEKPQKLIIPFEMRGYQG 139

  Fly   490 IYELPLKTHTAACKTLL 506
            :|.|..|.:.||.:.|:
plant   140 VYNLENKIYVAAARGLM 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11710NP_001285492.1 zf-C2HC5 120..168 CDD:283802
ASCH_ASC-1_like 367..478 CDD:119346 57/117 (49%)
AT2G20410NP_001324967.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2335
eggNOG 1 0.900 - - E1_KOG2845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004371
OrthoInspector 1 1.000 - - oto3982
orthoMCL 1 0.900 - - OOG6_103387
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3093
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.