DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11710 and SPAC1A6.01c

DIOPT Version :9

Sequence 1:NP_001285492.1 Gene:CG11710 / 33044 FlyBaseID:FBgn0031115 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_593192.1 Gene:SPAC1A6.01c / 2542431 PomBaseID:SPAC1A6.01c Length:455 Species:Schizosaccharomyces pombe


Alignment Length:326 Identity:83/326 - (25%)
Similarity:141/326 - (43%) Gaps:70/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 QNISKGA-------KGKSGKHVNLYASDGRVQGDTIILKG--------------RRHCDCQAGQH 130
            :|:|.|.       :.||.||.|  :|..|::|...|.|.              ||.|:||..:|
pombe   140 KNVSPGVMTSDLIPEKKSVKHNN--SSSNRIEGLADIEKAIRQIEISQNINKAERRVCNCQGRKH 202

  Fly   131 KL---INNCLGCGRIVCEQEGSGPCLSCGDPVRTPEEEQQLAKAAREKGG-TKSAAKQGKKS--- 188
            .|   ..|||.||:|:|..||.|||..|.:||.:..::.:|.:..:.:|. .|.||.|.:||   
pombe   203 PLNEAAPNCLNCGKIICIVEGIGPCTFCDNPVISKAQQLELIQELKHEGSRLKQAANQKRKSKTV 267

  Fly   189 --------------------TKELSTQALDKALAQRDRLLEYDKNSEKRTTVIDDELDYFQENSV 233
                                .|:|..:| .:|..:::.||.:|:.|.:||.:||:..| |...|:
pombe   268 SSKNNFQRLQNSSLHSIFLDPKQLEQKA-QEAEERKNVLLNFDRTSAQRTRIIDEAAD-FDPTSL 330

  Fly   234 ----WLSDAERE-KFEKLHREMEEVKHGSRMKRKIRVDFAGRE-LPEEPTISKEYEQQVISELAA 292
                |.|.||:. ...::.:.|  .|...:.|:.:.:..:|:: :.::...|.|...:...||..
pombe   331 ASDTWASPAEKALNLVRMQKAM--AKKEKKKKKVLSISLSGKKVVVDQKEASSESSDEDQDELDN 393

  Fly   293 VSKASGVGSNWSASSVTGHSALTLAPHLNMTKPPVYKPSKESKSWPAPAAGSDWLERTYNRVQDK 357
            ::|..|          ..||....||.:.....|:|.....|.....|.:..:.:.:.:::|||.
pombe   394 LTKVEG----------QSHSHNPKAPVIRNLPRPIYHQDLHSSHVAVPESILNKINQKWSKVQDD 448

  Fly   358 E 358
            :
pombe   449 D 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11710NP_001285492.1 zf-C2HC5 120..168 CDD:283802 22/50 (44%)
ASCH_ASC-1_like 367..478 CDD:119346
SPAC1A6.01cNP_593192.1 zf-C2HC5 192..244 CDD:283802 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I3319
eggNOG 1 0.900 - - E1_KOG2845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I1782
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004371
OrthoInspector 1 1.000 - - oto100436
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1813
SonicParanoid 1 1.000 - - X3093
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.