DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19d and Obp83cd

DIOPT Version :9

Sequence 1:NP_523421.2 Gene:Obp19d / 33040 FlyBaseID:FBgn0011280 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster


Alignment Length:181 Identity:39/181 - (21%)
Similarity:59/181 - (32%) Gaps:75/181 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLVGILCLGATSAKPHEEINR-----DHAAELANEC-KAETGATDEDVEQLMSHDLPER----- 63
            :|:...|||         .:|.     :|..|..|.| :...|.|.|:.|:|      ||     
  Fly     7 ILIALCLCL---------SLNEGLALLEHEGETINRCIQNYGGLTAENAERL------ERFKEWS 56

  Fly    64 ---HEAKCLRACVM-------------------------------KKLQIMDESGKLNKEHAIE- 93
               .|..|...|.:                               |||::..|||:.:.:||.| 
  Fly    57 DSYEEIPCFTRCYLSEMFDFYNNLTGFNKDGIVGVFGRPVYEACRKKLELPFESGESSCKHAYEG 121

  Fly    94 --LVKVMSKH-----DAEKEDAPAEVVAKCEAIETPEDHCDA-----AFAY 132
              .:..|..|     |.....:|:...|..:.::  :.|.|.     ||||
  Fly   122 FHCITNMESHPFTVIDNMPNISPSAKDAMKDCLQ--DVHQDEWKSFDAFAY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19dNP_523421.2 PBP_GOBP 23..139 CDD:279703 35/168 (21%)
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 21/104 (20%)
PhBP 149..242 CDD:214783 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.