DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19d and Obp83a

DIOPT Version :9

Sequence 1:NP_523421.2 Gene:Obp19d / 33040 FlyBaseID:FBgn0011280 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster


Alignment Length:135 Identity:28/135 - (20%)
Similarity:57/135 - (42%) Gaps:15/135 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTVLLLVGILCLGATSAKPHEEINRDHAAELA----NECKAETGATDEDVEQLMSHDLPERHEAK 67
            :.:.||.|.|.|...:|:..|........::|    :.|..:||.|:..:::....::.|..:.|
  Fly    37 IALSLLSGALILPPAAAQRDENYPPPGILKMAKPFHDACVEKTGVTEAAIKEFSDGEIHEDEKLK 101

  Fly    68 CLRACVMKKLQIMDESGKLNKEHAIELVKVMSKHDAEKEDAPAEVVAKCEAIETPEDH--CDAAF 130
            |...|...:::::|::|.      :.|.|:.:.......|...|:...|   ..||..  |..|:
  Fly   102 CYMNCFFHEIEVVDDNGD------VHLEKLFATVPLSMRDKLMEMSKGC---VHPEGDTLCHKAW 157

  Fly   131 AYEEC 135
            .:.:|
  Fly   158 WFHQC 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19dNP_523421.2 PBP_GOBP 23..139 CDD:279703 23/119 (19%)
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 21/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452918
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.