DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19d and Obp57c

DIOPT Version :9

Sequence 1:NP_523421.2 Gene:Obp19d / 33040 FlyBaseID:FBgn0011280 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster


Alignment Length:141 Identity:28/141 - (19%)
Similarity:64/141 - (45%) Gaps:16/141 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLVGILCLGATSAKPHEEINRDHAAELANECKAETGATDEDVEQLMSHDLPERHEA-------K 67
            :|.:.::|:...|....:.::........::|.|....:..:.::|:..:..|..:.       |
  Fly     1 MLKLWLICILTVSVVSIQSLSLLEETNYVSDCLASNNISQAEFQELIDRNSSEEDDLENTDRRYK 65

  Fly    68 CLRACVMKKLQIMDESGKLNKEHAIELVKVMSKHDAEKEDAPAEVVAKCEAI-ETPEDHCDAAFA 131
            |...|:.:|..::|.:|.|:.: .|:.::.:|       |...|::..|:.| :..||||:.||.
  Fly    66 CFIHCLAEKGNLLDTNGYLDVD-KIDQIEPVS-------DELREILYDCKKIYDEEEDHCEYAFK 122

  Fly   132 YEECIYEQMKE 142
            ...|:.|..::
  Fly   123 MVTCLTESFEQ 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19dNP_523421.2 PBP_GOBP 23..139 CDD:279703 24/123 (20%)
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 25/110 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.