DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19d and Obp56b

DIOPT Version :9

Sequence 1:NP_523421.2 Gene:Obp19d / 33040 FlyBaseID:FBgn0011280 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_611443.1 Gene:Obp56b / 37265 FlyBaseID:FBgn0046880 Length:137 Species:Drosophila melanogaster


Alignment Length:141 Identity:34/141 - (24%)
Similarity:61/141 - (43%) Gaps:20/141 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVHLTVLLLVGILCLGATSAKPHEEINRDHAAELA------NECKAETGATDEDVEQLMS-HDLP 61
            |::|.|:.|:..|         .|.:....|||||      ..|..|......|...|.: .::.
  Fly     3 LIYLLVVFLIFAL---------SELVAGQSAAELAAYKQIQQACIKELNIAASDANLLTTDKEVA 58

  Fly    62 ERHEA-KCLRACVMKKLQIMDESGKLNKEHAIELVKVMSKHDAEKEDAPAEVVAKCEAIETPEDH 125
            ...|: ||..:||.|||.::.:.||.|.:..::|.::  :..:...|....::..|...::... 
  Fly    59 NPSESVKCYHSCVYKKLGLLGDDGKPNTDKIVKLAQI--RFSSLPVDKLKSLLTSCGTTKSAAT- 120

  Fly   126 CDAAFAYEECI 136
            ||..:.||:|:
  Fly   121 CDFVYNYEKCV 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19dNP_523421.2 PBP_GOBP 23..139 CDD:279703 29/122 (24%)
Obp56bNP_611443.1 PhBP 35..135 CDD:214783 23/100 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012672
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.