DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19d and Obp44a

DIOPT Version :10

Sequence 1:NP_523421.2 Gene:Obp19d / 33040 FlyBaseID:FBgn0011280 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_610358.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster


Alignment Length:120 Identity:27/120 - (22%)
Similarity:46/120 - (38%) Gaps:18/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILC--LGATSAKPHEEINRDHAAELANECKAETGATDEDVEQLMSHDLPERHEAKCLRACVMKKL 77
            :||  ||..||..::....:.......||.|.:..|:..:.:..:.|.|:....:....|:..|.
  Fly     8 LLCALLGLASASDYKLRTAEDLQSARKECAASSKVTEALIAKYKTFDYPDDDITRNYIQCIFVKF 72

  Fly    78 QIMDESGKLNKEHAIELV------KVMSKHDAEK------EDAPAEVVA----KC 116
            .:.||:.....|:.:..:      |...|.|.||      :.:||...|    ||
  Fly    73 DLFDEAKGFKVENLVAQLGQGKEDKAALKADIEKCADKNEQKSPANEWAFRGFKC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19dNP_523421.2 PBP_GOBP 26..139 CDD:460193 21/107 (20%)
Obp44aNP_610358.1 PhBP 32..132 CDD:214783 21/96 (22%)

Return to query results.
Submit another query.