DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19d and Obp19c

DIOPT Version :9

Sequence 1:NP_523421.2 Gene:Obp19d / 33040 FlyBaseID:FBgn0011280 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_608392.1 Gene:Obp19c / 33039 FlyBaseID:FBgn0031111 Length:175 Species:Drosophila melanogaster


Alignment Length:114 Identity:26/114 - (22%)
Similarity:53/114 - (46%) Gaps:14/114 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TGATDEDVEQLMSHDLPE-----------RHEAKCLRACVMKKLQIMDESGKLNKEHAIELVKVM 98
            |.|..|.:::|   .||.           ..:.|||..||:||:::||...|||.....:|..::
  Fly    63 TAARMECIQKL---QLPRDQRPLGKVTNPSEKEKCLVECVLKKIKLMDADNKLNVGQVEKLTSLV 124

  Fly    99 SKHDAEKEDAPAEVVAKCEAIETPEDHCDAAFAYEECIYEQMKEHGLEL 147
            ::.:.......:.:...|....:.::.|:.|..:.:||..|::.:.::|
  Fly   125 TQDNKMAIAVSSSMAQACSRGISSKNPCEVAHLFNQCISRQLERNNVKL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19dNP_523421.2 PBP_GOBP 23..139 CDD:279703 24/104 (23%)
Obp19cNP_608392.1 PhBP 65..164 CDD:214783 23/101 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012672
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.