DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19d and Obp51a

DIOPT Version :9

Sequence 1:NP_523421.2 Gene:Obp19d / 33040 FlyBaseID:FBgn0011280 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_725436.1 Gene:Obp51a / 246666 FlyBaseID:FBgn0043530 Length:117 Species:Drosophila melanogaster


Alignment Length:139 Identity:31/139 - (22%)
Similarity:51/139 - (36%) Gaps:37/139 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VHLTVLLLVGILCLGATSAKPHEEINRDHAAELANECKAETGATDEDVEQLMSHDLPERHEAKCL 69
            |.:.::||:.:..|  :||....|         ||||..:.|.|.:..|     :.|.....||.
  Fly     3 VFIGLVLLLAVTTL--SSALFESE---------ANECAKKLGITPDYFE-----NFPHSSRVKCF 51

  Fly    70 RACVMKKLQIMDESGKLNKEHAIELVKVMSKHD-------AEKEDAPAEVVAKCEAIETPEDHCD 127
            ..|.|:||:|:...             |::..|       .|..|.....|..|..: :..|.|:
  Fly    52 YHCQMEKLEIIANG-------------VVTPFDLKVLNISPESYDKYGVKVKPCLKL-SHRDKCE 102

  Fly   128 AAFAYEECI 136
            ..:...:|:
  Fly   103 LGYLVFQCL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19dNP_523421.2 PBP_GOBP 23..139 CDD:279703 26/121 (21%)
Obp51aNP_725436.1 PBP_GOBP 25..114 CDD:279703 24/106 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.