DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19d and Obp83g

DIOPT Version :10

Sequence 1:NP_523421.2 Gene:Obp19d / 33040 FlyBaseID:FBgn0011280 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster


Alignment Length:120 Identity:28/120 - (23%)
Similarity:54/120 - (45%) Gaps:25/120 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTVLLLVGILCLGATSAKPHEEINRDHA-AELA-NECKAETGATDEDVEQLMSHDLPERHEAKCL 69
            |.::..|....:..|:||   .:.:||| ||.| .||:.:....|:..|:.::::.|......|.
  Fly     7 LLIVAAVATFLVAQTTAK---FLLKDHADAEKAFEECREDYYVPDDIYEKYLNYEFPAHRRTSCF 68

  Fly    70 RACVMKKLQIMDE-------------SGKLNK-----EHAIELVKVMSKHDAEKE 106
            ..|.::||::..|             :.|.:|     :|.:|  |.:..::||.:
  Fly    69 VKCFLEKLELFSEKKGFDERAMIAQFTSKSSKDLSTVQHGLE--KCIDHNEAESD 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19dNP_523421.2 PBP_GOBP 26..139 CDD:460193 23/101 (23%)
Obp83gNP_731043.1 PBP_GOBP 25..134 CDD:460193 23/99 (23%)

Return to query results.
Submit another query.