DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19c and Obp57e

DIOPT Version :10

Sequence 1:NP_608392.1 Gene:Obp19c / 33039 FlyBaseID:FBgn0031111 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_611488.1 Gene:Obp57e / 326110 FlyBaseID:FBgn0050145 Length:136 Species:Drosophila melanogaster


Alignment Length:84 Identity:25/84 - (29%)
Similarity:42/84 - (50%) Gaps:18/84 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KCLVECVLKKIKLMDADNKLNVGQVEK-LTSLVTQDNKMAIAVSSSMAQACSRGIS-SKNPCEVA 155
            ||.:.|||..:.|:  |.:.|| |::| :.|.|.....:||.:.:     |....| .::.||::
  Fly    56 KCFLTCVLLDLGLI--DERGNV-QIDKYMKSGVVDWQWVAIELVT-----CRIEFSDERDLCELS 112

  Fly   156 H-LFNQCISRQLERNNVKL 173
            : :|| |.      .:|||
  Fly   113 YGIFN-CF------KDVKL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19cNP_608392.1 PhBP 65..164 CDD:214783 22/73 (30%)
Obp57eNP_611488.1 PhBP 28..123 CDD:214783 22/81 (27%)

Return to query results.
Submit another query.