DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19c and Obp56i

DIOPT Version :10

Sequence 1:NP_608392.1 Gene:Obp19c / 33039 FlyBaseID:FBgn0031111 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster


Alignment Length:76 Identity:19/76 - (25%)
Similarity:36/76 - (47%) Gaps:5/76 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NPSEKEKCLVECVLKKIKLMDADNKLNVGQVEK-LTSLVTQDNKMAIAVSSSMAQACSRGISSKN 150
            :|....||...|.|:.|.:: |||::..|..:: |..:||.:....:..:.:|.::   ..|...
  Fly    49 DPGHSVKCFFRCFLENIGII-ADNQIIPGAFDRVLGHIVTAEAVERMEATCNMIKS---ETSHDE 109

  Fly   151 PCEVAHLFNQC 161
            .||.|...::|
  Fly   110 SCEFAWQISEC 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19cNP_608392.1 PhBP 65..164 CDD:214783 19/76 (25%)
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:460193 19/76 (25%)

Return to query results.
Submit another query.