DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19b and Obp99b

DIOPT Version :9

Sequence 1:NP_608391.2 Gene:Obp19b / 33038 FlyBaseID:FBgn0031110 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster


Alignment Length:122 Identity:29/122 - (23%)
Similarity:47/122 - (38%) Gaps:24/122 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DEVVELIEP---FGDACTPK-PSRENIVEMVLN---KEDAKHETKCFRHCMLEQFELMPEDQLQY 99
            |.||:..|.   :...|..| .:.|.:||....   .:||  .|.|:..|:.::|..       |
  Fly    24 DYVVKTHEDLTNYRTQCVEKVHASEELVEKYKKWQYPDDA--VTHCYLECIFQKFGF-------Y 79

  Fly   100 NEDKTVDM----INMMFPDRE----DDGRRIVKTCNEELKAEQDKCEAAHGIAMCML 148
            :.:...|:    |.:..|..|    |:..:.:..|.|....|.|.|..|:...||.:
  Fly    80 DTEHGFDVHKIHIQLAGPGVEVHESDEVHQKIAHCAETHSKEGDSCSKAYHAGMCFM 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19bNP_608391.2 PBP_GOBP 38..150 CDD:279703 29/122 (24%)
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 29/122 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.