DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19b and Obp83ef

DIOPT Version :10

Sequence 1:NP_608391.2 Gene:Obp19b / 33038 FlyBaseID:FBgn0031110 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster


Alignment Length:138 Identity:23/138 - (16%)
Similarity:50/138 - (36%) Gaps:29/138 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VLMGSATADEEEGSMTVDEVVELIEPFGDACTPKPSRENIVEMVLNKEDAKHETKCFRHCMLEQ- 88
            ::...|.||....:.|:::.:..:.      :|:....::.::.......:.|..|...|:..: 
  Fly    13 LICSQALADLSGDAQTLEKCLRQLS------SPESIAGDLRKLERYSSWTREEVPCLMRCLAREK 71

  Fly    89 --FELMPEDQ---LQYNEDKTVDMINMMFPDREDDGRRIVKTCNEEL-KAEQDKCEAAHGIAMCM 147
              |: :.|::   .|..||...|:.|.               |..|| :...|.|..|:....|:
  Fly    72 GWFD-VEENKWRLKQLTEDLGADVYNY---------------CRFELRRMGSDGCSFAYRGLRCL 120

  Fly   148 LREMRSSG 155
            .:....:|
  Fly   121 KQAEMHAG 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19bNP_608391.2 PBP_GOBP 39..150 CDD:460193 19/117 (16%)
Obp83efNP_731042.1 PhBP 28..124 CDD:214783 19/117 (16%)
PhBP 133..234 CDD:214783
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.