DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19b and Obp57c

DIOPT Version :10

Sequence 1:NP_608391.2 Gene:Obp19b / 33038 FlyBaseID:FBgn0031110 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster


Alignment Length:97 Identity:27/97 - (27%)
Similarity:43/97 - (44%) Gaps:10/97 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ENIVEMVLNKEDAKHET----KCFRHCMLEQFELMPEDQLQYNEDKTVDMINMMFPDREDDGRRI 122
            :.:::...::||....|    |||.||:.|:..|     |..|....||.|:.:.| ..|:.|.|
  Fly    44 QELIDRNSSEEDDLENTDRRYKCFIHCLAEKGNL-----LDTNGYLDVDKIDQIEP-VSDELREI 102

  Fly   123 VKTCNEELKAEQDKCEAAHGIAMCMLREMRSS 154
            :..|.:....|:|.||.|..:..|:......|
  Fly   103 LYDCKKIYDEEEDHCEYAFKMVTCLTESFEQS 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19bNP_608391.2 PBP_GOBP 39..150 CDD:460193 26/91 (29%)
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 26/92 (28%)

Return to query results.
Submit another query.