DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19b and Obp56a

DIOPT Version :9

Sequence 1:NP_608391.2 Gene:Obp19b / 33038 FlyBaseID:FBgn0031110 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster


Alignment Length:152 Identity:33/152 - (21%)
Similarity:62/152 - (40%) Gaps:19/152 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NLLLAVACAAVLMGSATADEEEGSMTVDEVVELIEPFGDACTPKPSRENIVEMVLNKEDAKHET- 78
            |....:|.:|:.:..|.......|   ||..:|.:...:.|..:.......:..:|.:|..:.| 
  Fly     2 NSYFVIALSALFVTLAVGSSLNLS---DEQKDLAKQHREQCAEEVKLTEEEKAKVNAKDFNNPTE 63

  Fly    79 --KCFRHCMLEQFELMPEDQLQYNEDKTVDMINMMFPDREDDGRRIVKTCNEELKAEQDKCEAAH 141
              |||.:|..|:...:.:.:||  |...::.:..:.  .|:..:..::.| ..:|.| :||:.|.
  Fly    64 NIKCFANCFFEKVGTLKDGELQ--ESVVLEKLGALI--GEEKTKAALEKC-RTIKGE-NKCDTAS 122

  Fly   142 GIAMCMLREMRSSGFK-IPEIK 162
            .:..|.      ..|| .||.|
  Fly   123 KLYDCF------ESFKPAPEAK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19bNP_608391.2 PBP_GOBP 38..150 CDD:279703 24/114 (21%)
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:279703 23/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.