DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp19b and Obp28a

DIOPT Version :9

Sequence 1:NP_608391.2 Gene:Obp19b / 33038 FlyBaseID:FBgn0031110 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_523505.1 Gene:Obp28a / 34031 FlyBaseID:FBgn0011283 Length:143 Species:Drosophila melanogaster


Alignment Length:161 Identity:36/161 - (22%)
Similarity:64/161 - (39%) Gaps:36/161 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LKMTNLLLAVACAAVLMGSATA---DEEEGSMTVDEVVELIEPFGDACTPK--PSRENIVEMVLN 70
            ::.|.::|.   |.||:|:|..   ||:|.      :.:|:|. .::|.|:  .:..::.|||..
  Fly     1 MQSTPIILV---AIVLLGAALVRAFDEKEA------LAKLMES-AESCMPEVGATDADLQEMVKK 55

  Fly    71 KEDAKHETKCFRHCMLEQFELMP-----------EDQLQYNEDKTVDMINMMFPDREDDGRRIVK 124
            :..:.:..||.|.|:::...::.           |...||..:.         |.:......|..
  Fly    56 QPASTYAGKCLRACVMKNIGILDANGKLDTEAGHEKAKQYTGND---------PAKLKIALEIGD 111

  Fly   125 TCNEELKAEQDKCEAAHGIAMCMLREMRSSG 155
            || ..:....|.||||.....|...|.:..|
  Fly   112 TC-AAITVPDDHCEAAEAYGTCFRGEAKKHG 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp19bNP_608391.2 PBP_GOBP 38..150 CDD:279703 24/124 (19%)
Obp28aNP_523505.1 PhBP 35..134 CDD:214783 22/108 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.