powered by:
Protein Alignment CG15459 and CG15458
DIOPT Version :9
Sequence 1: | NP_608389.2 |
Gene: | CG15459 / 33036 |
FlyBaseID: | FBgn0031108 |
Length: | 302 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_652293.1 |
Gene: | CG15458 / 50124 |
FlyBaseID: | FBgn0040651 |
Length: | 63 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 26/66 - (39%) |
Similarity: | 41/66 - (62%) |
Gaps: | 5/66 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAD--GFKKYFNGTTINGRANVAKATYATLALLFIVYKLRRGSGKTGELASGKCSCESDHESSLN 63
|:| .|.:.||..|:.|||||||||:|:|.|::::.|:.|.:.|..|. |..|:...::.|:
Fly 1 MSDHFNFNEAFNSQTMRGRANVAKATWASLGLVYVLVKMHRRNTKRRET---KLYCKGCQQAMLH 62
Fly 64 G 64
|
Fly 63 G 63
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006119 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_108639 |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR34038 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.910 |
|
Return to query results.
Submit another query.