powered by:
Protein Alignment CG15459 and Atp5mk
DIOPT Version :9
Sequence 1: | NP_608389.2 |
Gene: | CG15459 / 33036 |
FlyBaseID: | FBgn0031108 |
Length: | 302 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_598228.1 |
Gene: | Atp5mk / 171069 |
RGDID: | 631426 |
Length: | 58 |
Species: | Rattus norvegicus |
Alignment Length: | 35 |
Identity: | 19/35 - (54%) |
Similarity: | 23/35 - (65%) |
Gaps: | 0/35 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 GFKKYFNGTTINGRANVAKATYATLALLFIVYKLR 38
|.|||||..|:.||.|...|||..:|||.:.:|||
Rat 14 GIKKYFNSYTLTGRMNCVLATYGGIALLVLYFKLR 48
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
42 |
1.000 |
Domainoid score |
I12118 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006119 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_108639 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR34038 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
6 | 5.870 |
|
Return to query results.
Submit another query.