DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15459 and Atp5mk

DIOPT Version :9

Sequence 1:NP_608389.2 Gene:CG15459 / 33036 FlyBaseID:FBgn0031108 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_598228.1 Gene:Atp5mk / 171069 RGDID:631426 Length:58 Species:Rattus norvegicus


Alignment Length:35 Identity:19/35 - (54%)
Similarity:23/35 - (65%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GFKKYFNGTTINGRANVAKATYATLALLFIVYKLR 38
            |.|||||..|:.||.|...|||..:|||.:.:|||
  Rat    14 GIKKYFNSYTLTGRMNCVLATYGGIALLVLYFKLR 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15459NP_608389.2 ATP_synth_reg <4..38 CDD:291621 17/33 (52%)
Atp5mkNP_598228.1 ATP_synth_reg 1..51 CDD:373426 19/35 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12118
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108639
Panther 1 1.100 - - O PTHR34038
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.