powered by:
Protein Alignment CG15459 and atp5mk
DIOPT Version :9
Sequence 1: | NP_608389.2 |
Gene: | CG15459 / 33036 |
FlyBaseID: | FBgn0031108 |
Length: | 302 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004915907.1 |
Gene: | atp5mk / 101730293 |
XenbaseID: | XB-GENE-988869 |
Length: | 59 |
Species: | Xenopus tropicalis |
Alignment Length: | 35 |
Identity: | 18/35 - (51%) |
Similarity: | 23/35 - (65%) |
Gaps: | 0/35 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 GFKKYFNGTTINGRANVAKATYATLALLFIVYKLR 38
|.:||||..||.||.|...||||.:|.|.:.:||:
Frog 14 GIQKYFNAYTITGRRNCVLATYAGIAALILFFKLK 48
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006119 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.