Sequence 1: | NP_608388.2 | Gene: | HERC2 / 33035 | FlyBaseID: | FBgn0031107 | Length: | 4912 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_009382.2 | Gene: | ATS1 / 851213 | SGDID: | S000000018 | Length: | 333 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 338 | Identity: | 75/338 - (22%) |
---|---|---|---|
Similarity: | 113/338 - (33%) | Gaps: | 100/338 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 4157 VYAWGEGEDGKLGHGNRMSYDRP-KLVEHLNGMSVADIACGSAHSAAITASGHVLTWGKGRYGRL 4220
Fly 4221 GHGDSEDQL---RPKLVEALLGYRAIDIACGSGDAQTLCITDDDNVWSWGDGDY----------- 4271
Fly 4272 --------------------GKLGRGGSDGCKL----------PYKIESLAGLGVVKVECGSQFS 4306
Fly 4307 VALTKSG-------------------------------AVYTWGK--GDFHRLGHGSVDHVRRPK 4338
Fly 4339 KVAALQGKKIISIATGSLHCVACSDSGE-------VYTWGDNDEGQLG--DGTVTAIQRPRLVAA 4394
Fly 4395 LQGKHIVKVTCGS 4407 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HERC2 | NP_608388.2 | RCC1 | 638..683 | CDD:278826 | |
RCC1 | 687..737 | CDD:278826 | |||
RCC1 | 740..787 | CDD:278826 | |||
RCC1 | 790..841 | CDD:278826 | |||
RCC1_2 | 828..857 | CDD:290274 | |||
Cyt-b5 | 1290..1363 | CDD:278597 | |||
MIB_HERC2 | 1928..1987 | CDD:284184 | |||
UBA_HERC2 | 2515..2559 | CDD:270585 | |||
Cul7 | 2624..2699 | CDD:288381 | |||
APC10-HERC2 | 2762..2932 | CDD:176485 | |||
RCC1 | 3037..3088 | CDD:278826 | |||
RCC1 | 3091..3140 | CDD:278826 | |||
RCC1 | 3144..3194 | CDD:278826 | |||
RCC1 | 3197..3246 | CDD:278826 | |||
RCC1 | 3250..3298 | CDD:278826 | |||
RCC1 | 3302..3350 | CDD:278826 | |||
RCC1_2 | 4136..4166 | CDD:290274 | 4/8 (50%) | ||
RCC1 | 4154..4203 | CDD:278826 | 18/46 (39%) | ||
RCC1 | 4206..4257 | CDD:278826 | 15/53 (28%) | ||
RCC1 | 4260..4309 | CDD:278826 | 16/89 (18%) | ||
RCC1 | 4312..4360 | CDD:278826 | 10/80 (13%) | ||
RCC1 | 4364..4413 | CDD:278826 | 15/53 (28%) | ||
HECTc | 4509..4880 | CDD:238033 | |||
HECTc | 4553..4878 | CDD:214523 | |||
ATS1 | NP_009382.2 | ATS1 | 1..333 | CDD:227511 | 75/338 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |