DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and RUG3

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:NP_974971.2 Gene:RUG3 / 836208 AraportID:AT5G60870 Length:452 Species:Arabidopsis thaliana


Alignment Length:434 Identity:134/434 - (30%)
Similarity:204/434 - (47%) Gaps:74/434 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  4044 SWGGAST-------------------IYGWGHNHRGQL-GGLEGSRIKTPTPC--------EALS 4080
            |.|||:|                   ::.||....||| ||:|..|: .|:|.        ::.|
plant    24 SGGGANTKVPILYTSPDIDSDPVTLQLFSWGRGASGQLGGGIEEIRM-YPSPVANLLFRSDQSFS 87

  Fly  4081 LLRPVQLAGGEQSLFAV-----------TPDGKLFATGYGSGGRLGVGGSDSWAIPTLLGSLQHV 4134
            |.:.......:.|.|.:           |.||.|:..|.|.|||||.|..:|..:|.|....:..
plant    88 LAQTPGRIDADSSSFRIGISCGLFHSGLTIDGDLWIWGKGDGGRLGFGQENSVFVPNLNPLFEEH 152

  Fly  4135 FVKKVAVNSGGKHCLALTTEGEVYAWGEGEDGKLGHGNRMSYDR---PKLVEHLNGMSVADIACG 4196
            .::.:|:  ||.|.:|||.:|:|:.||.|..|.|||   ..|.|   |:.|:......::.||..
plant   153 SIRCIAL--GGLHSVALTHQGDVFTWGYGGFGALGH---KVYTRELVPRRVDDSWDCKISAIATS 212

  Fly  4197 SAHSAAITASGHVLTWGK----GRYGRLGHGDSEDQ----LRPKLVEALLGYRAIDIACGSGDAQ 4253
            ..|:||||.||.:..||:    ||.| ||.|...::    ..|..|:||. .....::||.  ..
plant   213 GTHTAAITESGELYMWGREEGDGRLG-LGPGRGPNEGGGLSVPSKVKALT-VPVASVSCGG--FF 273

  Fly  4254 TLCITDDDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTW 4318
            |:.:|.:..:|:||.....:||||.:.|...|..:.||.|:.:.::.||...|:|||:.|.|.:|
plant   274 TMALTKEGQLWNWGANSNYELGRGDNLGGWEPMPVPSLEGVRITQIACGGYHSLALTEEGKVLSW 338

  Fly  4319 GKGDFHRLGHGSVDHVRRPKKVAALQGKKIISIATGSLHCVA-------CSDSGEVYTWGDNDEG 4376
            |.|...:||..|:.:.:.|.::.||..|||:.||:|.....|       .:|.||::.||:..:.
plant   339 GHGGHGQLGSSSLRNQKVPTEIEALADKKIVFIASGGSSSAAITGWDWFLTDGGELWMWGNAKDF 403

  Fly  4377 QLGDGTVTAIQ-RPRLVAAL------QGKHIVKVTCGSAHTLAL 4413
            |||...:..|| .|..|..|      |...::.::.|::|.|.|
plant   404 QLGVPGLPEIQTTPVEVNFLTEEDECQPHKVISISIGASHALCL 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826
RCC1 3091..3140 CDD:278826
RCC1 3144..3194 CDD:278826
RCC1 3197..3246 CDD:278826
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274 12/29 (41%)
RCC1 4154..4203 CDD:278826 17/51 (33%)
RCC1 4206..4257 CDD:278826 17/58 (29%)
RCC1 4260..4309 CDD:278826 15/48 (31%)
RCC1 4312..4360 CDD:278826 17/47 (36%)
RCC1 4364..4413 CDD:278826 16/55 (29%)
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
RUG3NP_974971.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.