DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and AT5G12350

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:NP_568268.3 Gene:AT5G12350 / 831110 AraportID:AT5G12350 Length:1075 Species:Arabidopsis thaliana


Alignment Length:563 Identity:166/563 - (29%)
Similarity:241/563 - (42%) Gaps:100/563 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  3917 WFKRYCIAVRVAQSLIRRTE-----------LPRAFCLEVRKKFAEMLPSSSSNSNANPGCQSPG 3970
            ||......:.......||||           .||.:   .|:......|.||::|     .|..|
plant   120 WFTGLKALISHCHQRNRRTESRSDGTPSEANSPRTY---TRRSSPLHSPFSSNDS-----LQKDG 176

  Fly  3971 ASML-----------NSTTSLSSSTVSNVSPPPGI-----------TGEQPDLHCH-------AH 4006
            ::.|           |......|.......||.|.           :|....:|.|       |.
plant   177 SNHLRIHSPFESPPKNGLDKAFSDMALYAVPPKGFYPSDSATISVHSGGSDSMHGHMRGMGMDAF 241

  Fly  4007 QLESTSTLLHEDHTLFQAPHDAQLLQWLNRRPDDWALSWGGASTIYGWGHN-HRGQLGGLEGSR- 4069
            ::..:|.:....|   .:.||           |..||     ..::.||.. ..|.|||  |:| 
plant   242 RVSMSSAVSSSSH---GSGHD-----------DGDAL-----GDVFIWGEGIGEGVLGG--GNRR 285

  Fly  4070 ------IK----TPTPCEALSLLRPVQLAGGEQSLFAVTPDGKLFATGYGSGGRLGVGGSDSWAI 4124
                  ||    .|...|:..:|....:|.|.|....||..|:.|:.|..|.||||.|...:...
plant   286 VGSSFDIKMDSLLPKALESTIVLDVQNIACGGQHAVLVTKQGESFSWGEESEGRLGHGVDSNIQQ 350

  Fly  4125 PTLLGSLQHVFVKKVAVNSGGKHCLALTTEGEVYAWGEGEDGKLGHGNRMSYDRPKLVEH-LNGM 4188
            |.|:.:|....::.||  .|..|..|:|..|::|.||:|:.|.|||||.:|:..||.|.. |.|:
plant   351 PKLIDALNTTNIELVA--CGEFHSCAVTLSGDLYTWGKGDFGVLGHGNEVSHWVPKRVNFLLEGI 413

  Fly  4189 SVADIACGSAHSAAITASGHVLTWGKGRYGRLGHGDSEDQLRPKLVEALLGYRAIDIACG----- 4248
            .|:.||||..|:|.:|::|.:.|:|.|.:|.|||||.:....|:.|::|.|.|.:..|||     
plant   414 HVSSIACGPYHTAVVTSAGQLFTFGDGTFGVLGHGDKKSVFIPREVDSLKGLRTVRAACGVWHTA 478

  Fly  4249 -------SGDAQTLCITDDDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFS 4306
                   ...:.:.|  ....:::|||||.|:||.|..:...:|..:.:|......:|.||...:
plant   479 AVVEVMVGSSSSSNC--SSGKLFTWGDGDKGRLGHGNKEPKLVPTCVAALVEPNFCQVACGHSLT 541

  Fly  4307 VALTKSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQGKKII-SIATGSLHCVACSDSGEVYTW 4370
            ||||.||.|||.|...:.:||:...|. :.|.:|.....|..: .||.|:.|....:...|||||
plant   542 VALTTSGHVYTMGSPVYGQLGNSHADG-KTPNRVEGKLHKSFVEEIACGAYHVAVLTSRTEVYTW 605

  Fly  4371 GDNDEGQLGDGTVTAIQRPRLVAALQGKHIVKVTCGSAHTLAL 4413
            |....|:||.|.|.....|.||.:|:.|.:..:.||:..|.|:
plant   606 GKGSNGRLGHGDVDDRNSPTLVESLKDKQVKSIACGTNFTAAV 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826
RCC1 3091..3140 CDD:278826
RCC1 3144..3194 CDD:278826
RCC1 3197..3246 CDD:278826
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274 11/29 (38%)
RCC1 4154..4203 CDD:278826 24/49 (49%)
RCC1 4206..4257 CDD:278826 18/62 (29%)
RCC1 4260..4309 CDD:278826 15/48 (31%)
RCC1 4312..4360 CDD:278826 16/48 (33%)
RCC1 4364..4413 CDD:278826 19/48 (40%)
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
AT5G12350NP_568268.3 PH_PLC_plant-like 19..129 CDD:270171 2/8 (25%)
RCC1_2 310..339 CDD:290274 9/28 (32%)
RCC1 327..375 CDD:278826 16/49 (33%)
RCC1 378..428 CDD:278826 24/49 (49%)
RCC1 432..480 CDD:278826 18/47 (38%)
RCC1 496..544 CDD:278826 15/47 (32%)
RCC1 547..596 CDD:278826 16/49 (33%)
RCC1 601..648 CDD:278826 19/46 (41%)
FYVE 652..719 CDD:279674
BRX_N 911..946 CDD:290432
BRX 1006..1060 CDD:285568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3500
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.