DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and AT3G55580

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:NP_191117.1 Gene:AT3G55580 / 824723 AraportID:AT3G55580 Length:488 Species:Arabidopsis thaliana


Alignment Length:394 Identity:103/394 - (26%)
Similarity:162/394 - (41%) Gaps:112/394 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  4043 LSWGGASTIYGWGHNHRGQLGGLEGSRIKTPTP------------------CEALSLLRPVQLAG 4089
            ::||....:        ||.....|...:||.|                  |.|::..:.|...|
plant    86 ITWGSTDDL--------GQSYVTSGKHGETPEPFPLPPEVCVQKAEAGWAHCVAVTENQQVYTWG 142

  Fly  4090 GEQSLFAVTPDGKLFATGYG-----------------SGGRLGVGGSDSW--------------- 4122
            ..:.:    |.|::|....|                 |.|:...||:.|.               
plant   143 WRECI----PTGRVFGQVDGDSCERNISFSTEQVSSSSQGKKSSGGTSSQVEGRGGGEPTKKRRI 203

  Fly  4123 -------------------AIPTLLGSLQHVFVKKVAVNSGGKHCLALTTEGEVYAWGEGEDGKL 4168
                               |:|.|:.....|.:  |:|.:||:|.|||:..|:|:.||.|.:|:|
plant   204 SPSKQAAENSSQSDNIDLSALPCLVSLAPGVRI--VSVAAGGRHTLALSDIGQVWGWGYGGEGQL 266

  Fly  4169 GHGNRM---------------SYDR--------PKLVE--HLNGMSVADIACGSAHSAAITASGH 4208
            |.|:|:               ||.:        ..:|:  .:.|..|..||||..|||.||.:|.
plant   267 GLGSRVRLVSSPHPIPCIEPSSYGKATSSGVNMSSVVQCGRVLGSYVKKIACGGRHSAVITDTGA 331

  Fly  4209 VLTWGKGRYGRLGHGDSEDQLRPKLVEALLGYRAIDIACGSGDAQTLCITDDDNVWSWGDGDYGK 4273
            :||:|.|.||:.|.|.::|:|.|..|.:|||.|..::|.|..  .|.|.:.|.:|:::|...:|:
plant   332 LLTFGWGLYGQCGQGSTDDELSPTCVSSLLGIRIEEVAAGLW--HTTCASSDGDVYAFGGNQFGQ 394

  Fly  4274 LGRGGSDGCKLPYKIE--SLAGLGVVKVECGSQFSVALTKSGAVYTWGKGDFHRLGHGSVDHVRR 4336
            ||.|......||..:|  :|..:.|..:.||::.:..:|..|.|:.||...:.:||.|.|.....
plant   395 LGTGCDQAETLPKLLEAPNLENVNVKTISCGARHTAVITDEGRVFCWGWNKYGQLGIGDVIDRNA 459

  Fly  4337 PKKV 4340
            |.:|
plant   460 PAEV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826
RCC1 3091..3140 CDD:278826
RCC1 3144..3194 CDD:278826
RCC1 3197..3246 CDD:278826
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274 13/29 (45%)
RCC1 4154..4203 CDD:278826 22/73 (30%)
RCC1 4206..4257 CDD:278826 20/50 (40%)
RCC1 4260..4309 CDD:278826 14/50 (28%)
RCC1 4312..4360 CDD:278826 10/29 (34%)
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
AT3G55580NP_191117.1 ATS1 83..463 CDD:227511 102/392 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.