DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and Rcc1

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:XP_006239135.1 Gene:Rcc1 / 682908 RGDID:1592835 Length:434 Species:Rattus norvegicus


Alignment Length:343 Identity:100/343 - (29%)
Similarity:162/343 - (47%) Gaps:37/343 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  2988 VMVWGLNDKEQLG---GLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVSQDGKVYACG--EGT 3047
            |..:|.||:..||   .::||:: ||  .:...:.:.:.::.|......:::||:|:..|  ...
  Rat   101 VYSFGCNDEGALGRDTSVEGSEM-VP--GKVELQEKVVQVSAGDSHTAALTEDGRVFLWGSFRDN 162

  Fly  3048 NGRLGLGVTHNVPLPHQL-PVLRQYVVKKVAVHSGGKHALALTLDGKVFSWGEGEDGKLG----- 3106
            ||.:||    ..|:...: ||..|...:.|.|.||..|.:.||.||.:::.|.||.|:||     
  Rat   163 NGVIGL----LEPMKKSMVPVQVQLDTQVVKVASGNDHLVMLTTDGDLYTLGCGEQGQLGRVPEL 223

  Fly  3107 ---HGNRTTLDK---PRLVEALRAK------KIRDVACGSSHSAAISSQGELYTWGLGEYGRLGH 3159
               .|.|..|::   ||.| .|:::      :.:|..||:..:.|||.:|.:|.:||..|.:||.
  Rat   224 FANRGGRQGLERLLVPRCV-LLKSRGTRGRVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGT 287

  Fly  3160 GDNTTQLKPKLVTALAGRRVVQVACGSRDAQTLALTEDGAVFSWGDGDFGKLGRG-GSEGSDTPH 3223
            ....:...|:.:|:........|........|:.:..:|..:|.|..::|:||.| |:|....|.
  Rat   288 PGTGSCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPT 352

  Fly  3224 EIERLSGIGVVQIECGAQFSLALTRAGEVWTWGKGDYYRLGHGGDQHVRKPQPIGG--LRGRRVI 3286
            .|.||..:.  .:.|||....|:::.|.|:.||.|..|:||.|.:.....|..:.|  |..|.|:
  Rat   353 LISRLPVVS--SVACGASVGYAVSKDGRVFAWGMGTNYQLGTGQEDDAWSPVEMTGKQLENREVL 415

  Fly  3287 HVAVGALH-CLAVTDAGQ 3303
            .|:.|..| .|.|.|..|
  Rat   416 TVSSGGQHTVLLVKDKTQ 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826 17/53 (32%)
RCC1 3091..3140 CDD:278826 18/65 (28%)
RCC1 3144..3194 CDD:278826 11/49 (22%)
RCC1 3197..3246 CDD:278826 16/49 (33%)
RCC1 3250..3298 CDD:278826 18/50 (36%)
RCC1 3302..3350 CDD:278826 1/2 (50%)
RCC1_2 4136..4166 CDD:290274
RCC1 4154..4203 CDD:278826
RCC1 4206..4257 CDD:278826
RCC1 4260..4309 CDD:278826
RCC1 4312..4360 CDD:278826
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
Rcc1XP_006239135.1 ATS1 19..432 CDD:227511 99/340 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.