DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and rccd1

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:XP_009296664.1 Gene:rccd1 / 567613 ZFINID:ZDB-GENE-030131-3552 Length:312 Species:Danio rerio


Alignment Length:301 Identity:90/301 - (29%)
Similarity:123/301 - (40%) Gaps:92/301 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  3053 LGVTHNVPLP--------HQLPVLRQYVVKKVAVHSGGKHALALTLDGKVFSWGEGEDGKLGHGN 3109
            |...|...||        |:.|......:..|::..|.:|||.||.||.::|||.|..|:||||.
Zfish    61 LSAEHTAALPLVSGGFVQHKPPFFHPLKLCAVSLVLGSEHALLLTADGTLYSWGSGSHGQLGHGA 125

  Fly  3110 RTTLDKPRLVEALRAKKIRDVACGSSHSAAISSQGELYTWGLGEYGRLGHGDNTTQLKPKLVTAL 3174
            .|:|:.|:.||||....|:.||.|:.||||:||.|:||.||..|.|:||               |
Zfish   126 LTSLEDPQAVEALWGVPIKAVAAGNWHSAAVSSGGDLYMWGWNESGQLG---------------L 175

  Fly  3175 AGRRVVQVACGSRDAQTLALTEDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVV----- 3234
            ..|               .|.|:            |....||...|.|...:..|...|.     
Zfish   176 PSR---------------GLEEE------------KRRGNGSGNDDQPMNTDEKSQTDVFISIQA 213

  Fly  3235 --------------QIECGAQFSLALTRAGEVWTWGKGDYYRLGHGGDQHVRKPQPIGGLRGRRV 3285
                          :|.||::.:.|:|.||:::|||.|.|.:||||.:....:|.|:...     
Zfish   214 FPALVDIANMSEISRISCGSRHTAAVTSAGDLYTWGWGQYGQLGHGTEHSTDEPTPVDYF----- 273

  Fly  3286 IHVAVGALHCLAVTDAGQVYAWGDNDHGQQGSGNTFVNKKP 3326
                  :.|.|:|.|.            ..||.||||:..|
Zfish   274 ------SSHSLSVKDV------------VCGSWNTFVSVVP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826 11/42 (26%)
RCC1 3091..3140 CDD:278826 25/48 (52%)
RCC1 3144..3194 CDD:278826 11/49 (22%)
RCC1 3197..3246 CDD:278826 10/67 (15%)
RCC1 3250..3298 CDD:278826 14/47 (30%)
RCC1 3302..3350 CDD:278826 7/25 (28%)
RCC1_2 4136..4166 CDD:290274
RCC1 4154..4203 CDD:278826
RCC1 4206..4257 CDD:278826
RCC1 4260..4309 CDD:278826
RCC1 4312..4360 CDD:278826
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
rccd1XP_009296664.1 RCC1_2 92..120 CDD:290274 13/27 (48%)
RCC1 107..156 CDD:278826 25/48 (52%)
RCC1_2 143..172 CDD:290274 16/28 (57%)
RCC1 160..239 CDD:278826 23/120 (19%)
RCC1_2 226..255 CDD:290274 12/28 (43%)
RCC1 243..292 CDD:278826 20/71 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.