DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and nek8

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:XP_012812229.1 Gene:nek8 / 448753 XenbaseID:XB-GENE-990378 Length:698 Species:Xenopus tropicalis


Alignment Length:511 Identity:126/511 - (24%)
Similarity:199/511 - (38%) Gaps:146/511 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  3944 EVRKKFAEML---PSSSSNSN---ANPGCQSPGASMLNSTTSLSSSTVSNVSPP----PGITGEQ 3998
            |:|.....||   ||.....|   |:|.|.   .::||..:.:.|..:..|..|    |.::..:
 Frog   230 ELRHLILSMLNLDPSKRPQLNEIMAHPICI---PALLNLYSDIGSVKMRRVEKPLASVPAVSRVR 291

  Fly  3999 PDLHCHAHQLESTSTLLHEDHTLFQAPHDAQLLQWLNRRPDDWALSWGG--------------AS 4049
            |                                  .:|.|.  |.|.||              .|
 Frog   292 P----------------------------------ASRIPS--ARSRGGRVGHSPAKPGIPPPLS 320

  Fly  4050 TIYGWGHNHRGQLGGLEGSRIKTPTPCEALSLLRPVQLAGGEQSLFAVTPDGKLF---ATGYGSG 4111
            ::|.|            ||.|.||.....|: ...||::.|......||..|:|.   ||..|:|
 Frog   321 SVYTW------------GSGISTPLRLPMLN-TEVVQVSAGRTQKAGVTKSGRLIMWEATPVGTG 372

  Fly  4112 GRLGVGGSDSWAIPTLLGSLQHVFVKKVAVNSGGKHCLALTTEGEVYAWGEGEDGKLGHGNRMSY 4176
            .            |:|.||::|...:.::                                    
 Frog   373 A------------PSLPGSIEHAQPQFIS------------------------------------ 389

  Fly  4177 DRPKLVEHLNGMSVADIACGSAHSAAITASGHVLTWGKGRYGRLGHGDSEDQLRPKLVEALLGYR 4241
               :.:|..:|:::..::||...:|.:|..|.::|:|.|..|.|||.:..|..:||:||.||||.
 Frog   390 ---RFLEGQSGVTIKHVSCGDLFTACLTDRGIIMTFGSGSNGCLGHANFNDVTQPKIVEDLLGYE 451

  Fly  4242 AIDIACGSGDAQTLCITDDDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFS 4306
            .:.::||:..|  :.::::..|:|||.||.|:||.|..:....|.::.........:|.||...|
 Frog   452 IVHVSCGASHA--IAVSNEKEVFSWGRGDNGRLGLGSQESYNSPQQVIIPPEYEAQRVVCGIDSS 514

  Fly  4307 VALTKSGAVYTWGKGDFHRLGH---------GSVDHVRR-----PKKVAALQGKKIISIATGSLH 4357
            :.||.:..:...|...|::||.         .|.|.|..     |.:.|.|..:.|:....|:.|
 Frog   515 MILTVANQLLACGSNRFNKLGFDRILSASEPSSEDQVEEAYTFTPIQSAPLNQEAILCADVGTSH 579

  Fly  4358 CVACSDSGEVYTWGDNDEGQLGDGTVTAIQRPRLVAALQGKHIVKVTCGSAHTLAL 4413
            ....:..|:.||:|.|..||||.......:.|.||:||||..:..|.||.|:|:|:
 Frog   580 SAVVTALGQCYTFGSNQHGQLGTSAHRNSRVPCLVSALQGVKVTMVACGDAYTVAV 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826
RCC1 3091..3140 CDD:278826
RCC1 3144..3194 CDD:278826
RCC1 3197..3246 CDD:278826
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274 0/29 (0%)
RCC1 4154..4203 CDD:278826 5/48 (10%)
RCC1 4206..4257 CDD:278826 20/50 (40%)
RCC1 4260..4309 CDD:278826 15/48 (31%)
RCC1 4312..4360 CDD:278826 13/61 (21%)
RCC1 4364..4413 CDD:278826 21/48 (44%)
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
nek8XP_012812229.1 STKc_Nek8 3..258 CDD:270859 9/27 (33%)
S_TKc 4..256 CDD:214567 8/25 (32%)
ATS1 320..657 CDD:227511 103/382 (27%)
RCC1 421..465 CDD:278826 19/45 (42%)
RCC1 470..517 CDD:278826 15/46 (33%)
RCC1 587..635 CDD:278826 21/47 (45%)
RCC1 638..687 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.