DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC2 and rcc2

DIOPT Version :9

Sequence 1:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster
Sequence 2:NP_998341.1 Gene:rcc2 / 406455 ZFINID:ZDB-GENE-040426-2213 Length:495 Species:Danio rerio


Alignment Length:413 Identity:121/413 - (29%)
Similarity:188/413 - (45%) Gaps:68/413 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  4054 WGHNHRGQLGGLEGSRIKTPTPCEALSLLRPVQLAGGEQSLFAVTPDGKLFATGYGSGGRLGVGG 4118
            ||.:..|.|..::.|.: ...||.|.||:              :|.:|||::.|....|:||.|.
Zfish   110 WGPHRYGCLSDVQVSCV-VSGPCAAHSLI--------------ITTEGKLWSWGRNDKGQLGHGD 159

  Fly  4119 SDSWAIPTLLGSLQHVFVKKVAVNSGGKHCLALTTEGEVYAWGEGEDGKLGHGNRM-SYDRPKLV 4182
            :.....|.|:..|....:  ||...|..|.||||..|.||.:||.:.|:||.||:. :...|..:
Zfish   160 TKRLEAPKLIEGLGEEVI--VAAACGRNHTLALTENGTVYTFGENKLGQLGQGNQTDAVLSPATI 222

  Fly  4183 EHLNGMSVADIACGSAHSAAITASGHVLTWGKGRYGRLGHG------------DSEDQLRPKLVE 4235
            :: ||..:..:|||:..|..:...|::.::|...||:|||.            :.:.:|.|:.|.
Zfish   223 QY-NGQPIVKVACGAEFSMIVDCKGNLYSFGCPEYGQLGHNSDGKFIARAQRIEFDCELIPRRVA 286

  Fly  4236 ALL------------GYRAIDIACGSGDAQTLCITDDDNVWSWGDGDYGKLGRGGSDGCKLP--Y 4286
            ..:            ...|.|:|||:.  .||.:.....|:|||.|.||:||........:|  .
Zfish   287 IFIEKTKDGQVLPVPNVVARDVACGAN--HTLVLDSQKRVFSWGFGGYGRLGHAEQKDEMVPRLV 349

  Fly  4287 KIESLAGLGVVKVECGSQFSVALTKSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQGKKIISI 4351
            |:....|.|..::.||.|.|.||::.|.::.||      :.:.|.:....||.|..|.|.||.|:
Zfish   350 KLFDFPGRGATQIYCGYQCSFALSEMGGLFFWG------VTNTSRESTMYPKAVQDLCGWKIRSL 408

  Fly  4352 ATGSLHCVACSDSGEVYTWGDNDE-GQLGDG-----TVTAIQRPRLVAALQGKHIVKVTCGSAHT 4410
            |.|....:..:|...: :||.:.. |:||.|     :.|..|.   |..|.|.:..:|..|.:|:
Zfish   409 ACGKSSIIVAADDSTI-SWGPSPTFGELGYGDNKPKSSTTAQE---VKTLDGVYSEQVVMGYSHS 469

  Fly  4411 LALS---TSQLSERLRPLP--NP 4428
            |.::   |.|..|:|:.||  ||
Zfish   470 LVIARQDTEQEKEKLKKLPEYNP 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826
RCC1 3091..3140 CDD:278826
RCC1 3144..3194 CDD:278826
RCC1 3197..3246 CDD:278826
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274 13/29 (45%)
RCC1 4154..4203 CDD:278826 17/49 (35%)
RCC1 4206..4257 CDD:278826 17/74 (23%)
RCC1 4260..4309 CDD:278826 17/50 (34%)
RCC1 4312..4360 CDD:278826 14/47 (30%)
RCC1 4364..4413 CDD:278826 15/54 (28%)
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
rcc2NP_998341.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
RCC1 1 76..138 10/42 (24%)
RCC1_2 121..154 CDD:290274 11/47 (23%)
RCC1 2 141..192 18/52 (35%)
RCC1 141..190 CDD:278826 16/50 (32%)
RCC1 193..242 CDD:278826 17/49 (35%)
RCC1 3 194..244 17/50 (34%)
RCC1 245..318 CDD:278826 17/74 (23%)
RCC1 4 246..320 17/75 (23%)
Required for interaction with RAC1. /evidence=ECO:0000250|UniProtKB:Q9P258 291..298 0/6 (0%)
RCC1 5 321..374 19/52 (37%)
RCC1 323..372 CDD:278826 17/48 (35%)
RCC1 6 376..420 14/49 (29%)
RCC1 7 421..474 15/56 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.